Conserved Protein Domain Family
ccoP

?
TIGR00782: ccoP 
cytochrome c oxidase, cbb3-type, subunit III
This model describes a di-heme subunit of approximately 26 kDa of the cbb3 type copper and heme-containing cytochrome oxidase. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 129864
View PSSM: TIGR00782
Aligned: 5 rows
Threshold Bit Score: 356.127
Threshold Setting Gi: 446269034
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAC46111       3 KKPTTKKEVQTTGHSWDGIEELNTPLPRWWLWTFYATIVWGVAY-SIAMPAWPIFPsGATPGILRSSTRADVEKDIAKFA 81  Rhodobacter cap...
AAC44519      63 KGGRRVVEVPSTGHSWDGIEEYDNPLPRWWLWTFYATIVWGVLY-LIAYPAIPLVN-GATQGLLGQNYRSDVAAEIQRFN 140 Paracoccus deni...
WP_012173045  10 APVDGAGGPSTTGHEWDGIQELNNPLPRWWLWTFYATIIWAFGY-WVAYPAWPLVS-NYTSGVLGWNSRSAVVEQISDLQ 87  Azorhizobium ca...
WP_002244268  38 KRPKKGEEVQTTGHEWDGIAEYDNPLPRWWFWLCVLTWLFGIGY-LVMYPGVGDY-----KGLLKWTSHNQYEKEVKKAD 111 Neisseria menin...
WP_000346889  35 RDSKSQGELVENGHLIDGIGEFANNVPVGWIASFMCTIVWAFWYfFFGYPLNS------------FSQIGQYNEEVKAHN 102 Helicobacter py...
AAC46111      82 EMNKAVEDKLVATDVTAIAADPELVTYTRNAGAAVFRTWCAQCHGAGAGGNTGFPSLLDGDWLHGGSIETIYTNIKHGIR 161 Rhodobacter cap...
AAC44519     141 EANAPIQAKLVETPLEEIAADPELANYTANAGAAIFRTWCAQCHGSGAGGATGYPSLLDNDWLWGGTLEEIHTTVMHGIR 220 Paracoccus deni...
WP_012173045  88 KLRAASSAKLANVPLEDIEKNPELLSLARAEGKVAFADNCAPCHGAGGGGAKGFPNLNDDDWLWGGTLAQIQQTITHGIR 167 Azorhizobium ca...
WP_002244268 112 EQYGKLYAKFADMPIEKVAKDPQAKQIAQN----LFNTYCIQCHGSDAKGSKGFPNLTDSDWLWGGDPDKIHETIEKGR- 186 Neisseria menin...
WP_000346889 103 QKFEAKWKHLGQKELVDMGQG-------------IFLVHCSQCHGITAEGLHGS---AQNLVRWG-KEEGIMDTIKHGSK 165 Helicobacter py...
AAC46111     162 DPLDPDTLpVANMPAHLtdELLEPAQIDDVVQYVLKIS---GQPADEARATAGQQVFAD---NCVSCHGEDAKGMVEMGA 235 Rhodobacter cap...
AAC44519     221 DPKDADTR-YSEMPRFGidGLLENAQISQVVNHVLELG---GLPHDAALAAEGVEVFAD---NCSSCHAEDGTGDRAQGA 293 Paracoccus deni...
WP_012173045 168 SGDDEGHQ--GNMLAFG--SILSKADISNVADYVRSLSg--AAPGDTPAAKKGAEIFAA---NCATCHGENGKGNQELGS 238 Azorhizobium ca...
WP_002244268 187 ---------VATMPAWG--PALGEEGVKDVAHYVMSLSk-pEGQYDEERAARGQALFSGppaNCFTCHGDKGQGIQGLG- 253 Neisseria menin...
WP_000346889 166 ----GMDYlAGEMPAM----ELDEKDAKAIASYVMAELssvKKTKNPQLIDKGKELFESm--GCTGCHGNDGKGLQENQ- 234 Helicobacter py...
AAC46111     236 PNLTDGIWLYGGD--AKTITTTIQLGRGGVMPSWSwaadgakPRLSEAQIRAVASYVHSLGGGQ 297 Rhodobacter capsulatus
AAC44519     294 PDLTDAVWLYGSD--PATITRIVRDGPFGVMPAWT-------GRLSEADIVAVAAYVHSLGGGE 348 Paracoccus denitrificans PD1222
WP_012173045 239 KNLTDGIWLYGGD--KATIVQTITNGRGGVMPAWG-------PRLSPTTIKALTVYVHTLGGGQ 293 Azorhizobium caulinodans
WP_002244268 254 PNLTDDVWLWGGT--QKSIIETITNGRSSQMPAWG-------HFLDKDKLHIMTAYVWGLSDKD 308 Neisseria meningitidis
WP_000346889 235 -VFAADLTAYGTEnfLRNILTHGKKGNIGHMPSFKy------KNFSDLQVKALAEFIQSLkple 291 Helicobacter pylori
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap