Conserved Protein Domain Family
ccoO

?
TIGR00781: ccoO 
cytochrome c oxidase, cbb3-type, subunit II
This model describes the monoheme subunit of the cbb3-type cytochrome oxidase, found in a subset of Proteobacterial species. Species having this protein also have CcoN (subunit I, containing copper and two heme groups), CcoP (subunit III, containing two hemes), and CcoQ (essential for incorporation of the prosthetic groups). [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 129863
View PSSM: TIGR00781
Aligned: 4 rows
Threshold Bit Score: 364.235
Threshold Setting Gi: 488141388
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAC46109       7 HHVLEKNATLLLIFAFLVVTIGGIVEIAPLFYLENTIEKVEGMRPYTPLELTGRDIYIREGCYVCHSQMIRPMRDEVERY 86  Rhodobacter cap...
AAB58265       8 HQILEKNATLLLVGSLLVVSIGGIVEIAPLFYLQNTIEKVEGIRPYTPLELAGRNIYIREGCYLCHSQMIRPFRDEVERY 87  Rhizobium legum...
WP_000490788   2 FSFLEKNPFFFTLAFIFVFAIAGLVEILPNFFKS--ARPIEGLRPYTVLETAGRQIYIQEGCYHCHSQLIRPFQAEVDRY 79  Helicobacter py...
WP_002212596   4 QQLAEEKIGVLIVFTLLVVSVGLLIEVVPLAFTKAATQPAPGVKPYNALQVAGRDIYIREGCYNCHSQMIRPFRAETERY 83  Neisseria
AAC46109      87 GHYSLAAESMYDHPFQWGSKRTGPDLARVGGRYSDAWHVEHLSNPQSVVPESVMPSYSYLANVPLDSTWIEDRVSTDALV 166 Rhodobacter cap...
AAB58265      88 GHYSLAAESMYDHPFQWGSKRTGPDLARVGARYSNEWHVQHLADPRAVVPESIMPSYAFLKEQRVTVKDVGMDLKANEDV 167 Rhizobium legum...
WP_000490788  80 GAYSLSGEYAYDRPFLWGSKRIGPDLHRVGDYRTTDWHEKHMFDPKSVVPHSIMPAYKHLFTKKSDFDTAYAEALTQKKV 159 Helicobacter py...
WP_002212596  84 GHYSVAGESVYDHPFQWGSKRTGPDLARVGGRYSDEWHRIHLLNPRDVVPESNMPAFPWLARNKVDVDATVANMKALRKV 163 Neisseria
AAC46109     167 -GVPYSAEMIAAAKADFVAQADPNADSATLVANYgEKVNIRNFDGKPg-LTEMDALVAYLQVLGTMVDFSTFQPV 239 Rhodobacter capsulatus
AAB58265     168 -GVPYDDDMLANAEADMKAQADPNADTTALLARY-PKAKTGDFDGDPaaLTEMDALVSYLQMLGTLVDFSTYDDA 240 Rhizobium leguminosa...
WP_000490788 160 fGVPYDTENGVKLGSVEEAKKAYLEEAKKITADMkDKRVLEAIERGE--VLEIVALIAYLNSLGNSRINANQNAK 232 Helicobacter pylori
WP_002212596 164 -GTPYSDEEIAKA-PEALANK-----------------------------SELDAVVAYLQGLGLALKNVR---- 203 Neisseria
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap