Conserved Protein Domain Family
ccoN

?
TIGR00780: ccoN 
cytochrome c oxidase, cbb3-type, subunit I
This model represents the largest subunit, I, of the ccb3-type cytochrome c oxidase, with two protohemes and copper. It shows strong homology to subunits of other types of cytochrome oxidases. Species with this type, all from the Proteobacteria so far, include Neisseria meningitidis, Helicobacter pylori, Campylobacter jejuni, Rhodobacter sphaeroides, Rhizobium leguminosarum, and others. Gene symbols ccoN and fixN are synonymous. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 129862
View PSSM: TIGR00780
Aligned: 3 rows
Threshold Bit Score: 705.862
Threshold Setting Gi: 447080439
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAC44516      64 PETQYmdDVVRAGVIATAFWGVVGFLVGVVIAFQLAFPALNLSDITMgYTNFGKLRPLHTSAVIFAFGGNGLIATSFYVV 143 Paracoccus deni...
WP_002212595   8 QTYNY--KVVRQFAIMTVVWGIVGMLVGVIVAAQLFAPALDLSNIGP-WFHFGRLRPLHTNAVIFAFGGCGLIGTSYYVV 84  Neisseria menin...
WP_001157695   7 LSYDY--SISKLFLYAMVGFGIVGMLIGIVLAFELSFPNLNY--IAGeYGIFGRLRPLHTNAVIYGFTLGGIWASWYYIG 82  Helicobacter py...
AAC44516     144 QR----TSAARLWGGNAAWFVFWGYQLFIVLAATGYILGATQSKEYAEPEWYVDWWLTVVWVVYLAVFLGTILKRKEPHI 219 Paracoccus deni...
WP_002212595  85 QR----TCNTRLFGGWLPAFTFWGWQAVIVAAVVSFPMGWTQGKEYAELEWPIDILITLVWVAYAIVFFGTIAKRKIKHI 160 Neisseria menin...
WP_001157695  83 QRvlkiTYHQHPFLKIVGLLHFWLWIILLILGVISLFAGLTQSKEYAELMWPLDIIVVVAWVLWGVNMFGSMSVRRENTI 162 Helicobacter py...
AAC44516     220 YVANWFYLSFIVTIAMLHIVNNLAIPVSLFg-----sKSVQLFSGVQDAMTQWWYGHNAVGFFLTAGFLGMMYYFIPKQA 294 Paracoccus deni...
WP_002212595 161 YVANWFYGGFILAVALLHIVNNISIPAGLM-------KSYPVYSGAIDAMVQWWYGHNAVGFFLTAGFLGMMYYFVPKQA 233 Neisseria menin...
WP_001157695 163 YVSLWYYIATYVGIAVMYIFNNLSVPTYFVadmgsvwHSISMYSGSNDALIQWWWGHNAVAFVFTSGVIGTIYYFLPKES 242 Helicobacter py...
AAC44516     295 ERPVYSYKLSIIHFWALIFLYIWAGPHHLHYTALPDWASTLGMVFSIILWMPSWGGMINGLMTLSGAWDKLRTDPIIRMM 374 Paracoccus deni...
WP_002212595 234 ARPVYSYRLSVVHFWALIFTYMWAGPHHLHYTALPDWTQSLGMVLSLILFAPSWGGMINGIMTLSGAWDKLRTDPILKFL 313 Neisseria menin...
WP_001157695 243 GQPIFSYKLTLFSFWSLMFVYIWAGGHHLIYSTVPDWVQTLSSVFSVVLILPSWGTAINMLLTMRGQWHQLKESPLIKFL 322 Helicobacter py...
AAC44516     375 VVAVGFYGMATFEGPMMSIKAVNFVSHYTDWTIGHVHSGALGWNGMITFGALYYLVPRLWGRERLYSTGLVSWHFWLATI 454 Paracoccus deni...
WP_002212595 314 IVSLSFYGMSTFEGPMMSIKTVNALSHYTDWTVAHVHAGALGWVGFVTIGSVYYMIPRLFGKEQMHSTKLVEAHFWIATI 393 Neisseria menin...
WP_001157695 323 VLASTFYMLSTLEGSIQAIKSVNALAHFTDWIIGHVHDGVLGWVGFTLIASMYHMTPRLFKRE-IYSGRLVDFQFWIMTL 401 Helicobacter py...
AAC44516     455 GLVLYAASMWVSGIMEGLMWREVDAQGFLVNAFADTVAAKFPMNVVRALGGVLYLGGALIMCYNLWATVAKQPKTQSTAA 534 Paracoccus deni...
WP_002212595 394 GVVLYIAAMWIAGVMQGLMWSSLNDDGTLTYSFVESVKRTMPYYVIRFAGGLLYLSGMCIMAYNVYRTAIGGKAVDAEIP 473 Neisseria menin...
WP_001157695 402 GIVLYFSSMWIAGITQGMMWRDVDQYGNLTYQFIDTVKVLIPYYNIRGVGGLMYFIGFIIFAYNIFMTITAGKKLEREPN 481 Helicobacter py...
AAC44516     535 AVPAE 539 Paracoccus denitrificans PD1222
WP_002212595 474 AVSQT 478 Neisseria meningitidis
WP_001157695 482 YATPM 486 Helicobacter pylori
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap