Conserved Protein Domain Family
cad

?
TIGR00779: cad 
cadmium resistance transporter (or sequestration) family protein
These proteins are members of the Cadmium Resistance (CadD) Family (TC 2.A.77). To date, this family of proteins has only been found in Gram-positive bacteria. The CadD family includes several closely related Staphylococcal proteins reported to function in cadmium resistance. Members are predicted to span the membrane five times; the mechanism of resistance is believed to be export but has also been suggested to be binding and sequestration in the membrane. Closely related but outside the scope of this model is another staphylococcal protein that has been reported to possibly function in quaternary ammonium ion export. Still more distant are other members of the broader LysE family (see Vrljic. et al, ). [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 129861
View PSSM: TIGR00779
Aligned: 3 rows
Threshold Bit Score: 229.69
Threshold Setting Gi: 1916729
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAA26611  26 YVATGIDylviliLLFSQVK-KGQVKHIWIGQYIGTAIVIGASLLVAQGVVnLIPQQWViGLLGLLPLYLGVKIWIKGEe 104 Staphylococcus aureus
CAA78974  12 KTSEGLK------GNQTENK-HISPKDIIIGQYLGFTLLVVVSLLGTFGVM-LIPEKWV-GLLGLIPIYLGIMLFIKGE- 81  Bacillus firmus
AAB51227  16 YIATAVDllvillIFFARAKtRKEYRDIYVGQYLGSIILILVSLFLAFVLN-YVPEKWIlGLLGLIPIYLGIKVAIYDDc 94  Staphylococcus aureus
AAA26611 105 DEDESSILSLFSSGKFNQLFLTMIFIVLAS-SADDFSIYIPYFTTLSMSEIFIVTIVFLIMVGVLCYVSYRLASFDFISE 183 Staphylococcus aureus
CAA78974  82 DEDENAILSSLNSGKYNSVFLSVAFITFAN-GGDNIGIYVPFFSTLTMNQLAVTVITFFIMVAIWCFIGYRLAAFKHVSE 160 Bacillus firmus
AAB51227  95 EGEKRAKKELNEKG-LSKLVGTVAIVTISScGADNIGLFVPYFVTLSVTNLLLTLFVFLILIFFLVFTAQKLANIPGIGE 173 Staphylococcus aureus
AAA26611 184 TIEKYERWIVPIVFIGLGIYILFENGTSNALISFLL 219 Staphylococcus aureus
CAA78974 161 TLENYGRWIIPIVFIGLGIYIMVENETFSALLSLIN 196 Bacillus firmus
AAB51227 174 IVEKFSRWIMAIIYIALGLFIIIENDTIQTILGFIF 209 Staphylococcus aureus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap