1KNC


Conserved Protein Domain Family
ahpD

?
TIGR00777: ahpD 
Click on image for an interactive view with Cn3D
alkylhydroperoxidase, AhpD family
Members of this family are alkylhydroperoxidases, which catalyze the reduction of peroxides to their corresponding alcohols via oxidation of cysteine residues. In these alkylhydroperoxidases, the cysteines are located in a conserved -CXXC- motif located towards the COOH terminus. In Mycobacterium tuberculosis, two non-homologous alkylhydroperoxidases, AhpD and AhpC, are found in the same operon. [Cellular processes, Detoxification]
Statistics
?
PSSM-Id: 129859
View PSSM: TIGR00777
Aligned: 4 rows
Threshold Bit Score: 229.467
Threshold Setting Gi: 499223985
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1KNC_A         2 SIEKLKAALPEYAKDIKLNLSSITRSSVLDQEQLWGTLLASAAATRNPQVLADIGAEATDH-LSAAARHAALGAAAIMGM 80  Mycobacterium t...
AAF06743       2 SLDSLKSAVPDYAKDLKLNLGSVIGNSDLPAQQLWGTVLATAIASRSPIVLRELEPEAKAN-LSPEAYSAAKSAAAVMAM 80  Streptomyces co...
WP_010921525   2 SIEALRARLPDYAHDLGTNLALLVDDPALDPEARWGCFVASACAVGEPQTLRAIDAAATAAgLTAEANRAARKAAAMMAM 81  Caulobacter vib...
Q57353         2 SIEKLKAALPEYAKDIKLNLSSITRSSVLDQEQLWGTLLASAAATRNPQVLADIGAEATDH-LSAAARHAALGAAAIMGM 80  Mycobacterium t...
1KNC_A        81 NNVFYRGRGFLEG-RYDDLRPGLRMNIIANPGIPKANFELWSFAVSAINGCSHCLVAHEHTLRTVGVDREAIFEALKAAA 159 Mycobacterium t...
AAF06743      81 NNVFYRTRHLLSDhEYGTLRAGLRMNVIGNPGVDKVDFELWSFAVSAINGCGMCLDSHEQVLRKAGVDRETIQEAFKIAA 160 Streptomyces co...
WP_010921525  82 TNVYFRAVHLMEGaAYQALPCRLRLNRLAHAGARGVTYDLSCVAVSAINGCGACLDSHEADLRGRGVEPTQIQAALRIAA 161 Caulobacter vib...
Q57353        81 NNVFYRGRGFLEG-RYDDLRPGLRMNIIANPGIPKANFELWSFAVSAINGCSHCLVAHEHTLRTVGVDREAIFEALKAAA 159 Mycobacterium t...
1KNC_A       160 IVSGVAQALATIEALSPS 177 Mycobacterium tuberculosis H37Rv
AAF06743     161 VVEAVGVTLDAEAVLAAE 178 Streptomyces coelicolor A3(2)
WP_010921525 162 VVSAVARTLAAEAALHPQ 179 Caulobacter vibrioides
Q57353       160 IVSGVAQALATIEALSPS 177 Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap