Conserved Protein Domain Family
NhaD

?
TIGR00775: NhaD 
Na+/H+ antiporter, NhaD family
These proteins are members of the NhaD Na+:H+ Antiporter (NhaD) Family (TC 2.A.62). A single member of the NhaD family has been characterized. This protein is the NhaD protein of Vibrio parahaemolyticus which has 12 GES predicted transmembrane regions. It has been shown to catalyze Na+/H+ antiport, but Li+ can also be a substrate. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 129857
View PSSM: TIGR00775
Aligned: 3 rows
Threshold Bit Score: 518.292
Threshold Setting Gi: 3123728
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD19152   1 MLKLQLCALFLFGYLAIVFEHIVRVNKSAIALAMGGLMWLVCFSHIPMADHMILVEEIADMSQVIFFLFSAMAIVELIDA 80  Chlamydophila pneum...
AAC68454   1 MLKFQLCLLFLFGYLTIVFEHIVRVNKSAVSLAMGGLMWLVCFSHIPHIDHVMMFEEIADMAQVIFFLFAAMAIVELIDA 80  Chlamydia trachomat...
BAA25994   1 ----------------MRKSKPVLLAAGLIWILIG---YTFAQHHQQDVAKAALEHNLLEYAELLLFLLVAMTYINAMEE 61  Vibrio parahaemolyt...
AAD19152  81 HKGFSVIVKFCRIQSR--TLLLWALIGLSFFLSAALDNLTSIIIIISILKRLVKAREDRLLLGAI-CVIAVNAGGAWTPL 157 Chlamydophila pneum...
AAC68454  81 HRGFSIVVRCCNVESR--SVLLWVLLTLSFFLSAALDNLTSIIIIISILKRLVKAREDRLLLGAL-CVIGVNAGGAWTPL 157 Chlamydia trachomat...
BAA25994  62 RKLFDALQAWMVGKGFgfKKLFWLTGFLAFVISPIADNLTTALLMCAVVMKVSGDNPRFVNLACInIVIAANAGGAFSPF 141 Vibrio parahaemolyt...
AAD19152 158 GDVTTTMLWINNKITSWGIIRALFVPSLVCVLVAGFCGQFFLRKRGSTLIAKDVELQSAPPKSLWIIFIGLGSLLMVPVW 237 Chlamydophila pneum...
AAC68454 158 GDVTTTMLWINDKISTSGIITTLFLPSVVCVVIAGICGQLLLKKRRCSGLSEDLDREPALPKSNLIACVGFGSLLMVPMW 237 Chlamydia trachomat...
BAA25994 142 GDITTLMVWQAGHVRFS-EFMPLFVPSLINYVVPAFLMALFVPNTKPNTIHEHVELKRG---ARRIVLLFVLTIATAVSF 217 Vibrio parahaemolyt...
AAD19152 238 KACLGLPPFMGALLGLGLVWLTSDWI-----HS-------------PHGEDRYHLRVP----HILTKIDISSITFFIGIL 295 Chlamydophila pneum...
AAC68454 238 KAVLGVPPFMGALLGLGLVWLVSDWI-----HS-------------PHGEGRNHLRMP----HILTRIDISSVTFFIGIL 295 Chlamydia trachomat...
BAA25994 218 HAVLHFPPVVGMMMGLAYLQFFGYFLrktlkHSlakkaamaiangdDHALKRLGSVVPfdvfHRVSRAEWDTLLFFYGVV 297 Vibrio parahaemolyt...
AAD19152 296 LAVNALSFANLLTDFSLWMDKIFSRNVVAIVIGLLSSVLDNVPLVAATMGMYTLPLDDTLWKLIAYAAGTGGSILIIGSA 375 Chlamydophila pneum...
AAC68454 296 LAVNALTYSHVLRDLSVSMDALFSRNTLAVLLGLVSSVLDNVPLVAATIGMYDLPMNDPLWKLIAYTAGTGGSILIIGSA 375 Chlamydia trachomat...
BAA25994 298 MCVGGLSLLGYLELVSNVMYTQWNPVWANVMVGVLSAIVDNIPVMFAVLTMDPS-MSTGNWLLVTLTAGVGGSLLSIGSA 376 Vibrio parahaemolyt...
AAD19152 376 AGVAFMGLEKVDFLWYFKRISWIALASYFGGLFSYFVLES-LNFFI 420 Chlamydophila pneumoniae CWL029
AAC68454 376 AGVAYMGMEKVSFGWYVKHASWIALASYFGGLAVYFLMENcVSLFV 421 Chlamydia trachomatis D/UW-3/CX
BAA25994 377 AGVALMGAARGQYT-FFGHLKWTPVIALGYAPVLPLICG------- 414 Vibrio parahaemolyticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap