Conserved Protein Domain Family
NhaB

?
TIGR00774: NhaB 
Na+/H+ antiporter NhaB
These proteins are members of the NhaB Na+:H+ Antiporter (NhaB) Family (TC 2.A.34). The only characterised member of this family is the Escherichia coli NhaB protein, which has 12 GES predicted transmembrane regions, and catalyses sodium/proton exchange. Unlike NhaA this activity is not pH dependent. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 129856
View PSSM: TIGR00774
Aligned: 4 rows
Threshold Bit Score: 860.325
Threshold Setting Gi: 2506894
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAA12073       1 MPISLG--NAFIKNFLGKAPDWYKVAIIAFLIINPIVFFLINPFVAGWLLVAEFIFTLAMALKCYPLQPGGLLAIEAIAI 78  Vibrio parahaem...
BAA12086       1 MPISLG--NAFIKNFLGKAPDWYKVAIIAFLIINPIVFFLINPFVAGWLLVAEFIFTLAMALKCYPLQPGGLLAIEAIAI 78  Vibrio alginoly...
P27377         1 MEISWG--RALWRNFLGQSPDWYKLALIIFLIVNPLIF-LISPFVAGWLLVAEFIFTLAMALKCYPLLPGGLLAIEAVFI 77  Escherichia coli
WP_005693738   5 MEFTMTniQAFMKNFLGASPEWYKLAIVVFLIINPIVFFFISPFIAGWLLVAEFIFTLAMALKCYPLQPGGLLAIEAIII 84  Haemophilus inf...
BAA12073      79 GMTSPAQVKHELVANIEVLLLLVFMVAGIYFMKQLLLFIFTKILLGIRSKTLLSLAFCFAAAFLSAFLDALTVIAVVISV 158 Vibrio parahaem...
BAA12086      79 GMTSPAQVKHELVANIEVLLLLVFMVAGIYFMKHLLLFIFTKILLGIRSKTLLSLAFCFAAAFLSAFLDALTVIAVVISV 158 Vibrio alginoly...
P27377        78 GMTSAEHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFTRLLLSIRSKMLLSLSFCVAAAFLSAFLDALTVVAVVISV 157 Escherichia coli
WP_005693738  85 GMTNAKHVKAEIMANFEVILLLIFMVAGIFFMKQLLLYVFTKLLVKIRSKIALSIAFCFSAAFLSAFLDALTVVAVIISV 164 Haemophilus inf...
BAA12073     159 AVGFYSIYHKVASGNP-IGDHDHTQDDTITELTRDDLENYRAFLRSLLMHAGVGTALGGVTTMVGEPQNLIIADQAGWLF 237 Vibrio parahaem...
BAA12086     159 AIGFYSIYHKVASGNP-IGDHDHTQDDTITELTRDDLENYRAFLRSLLMHAGVGTALGGVTTMVGEPQNLIIADQAGWLF 237 Vibrio alginoly...
P27377       158 AVGFYGIYHRVASSR--TEDTDLQDDSHIDKHYKVVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAAGWHF 235 Escherichia coli
WP_005693738 165 AMGFYGVYHKVASGNNlIDAVDISDDRKIIEQQHEILEKFRAFLRSLMMHAGVGTALGGVMTVVGEPQNLIIAEQAKWNF 244 Haemophilus inf...
BAA12073     238 GEFLIRMSPVTLPVFICGLITCALVEKLKVFGYGAQLPDNVRQILVDFDREERKTRTNQDVAKLWVQGIIAVWLIVALAL 317 Vibrio parahaem...
BAA12086     238 GEFLIRMSPVTLPVFFCGLITCALVEKLKVFGYGAKLPNNVRQILVDFDNEERKTRTNQDVAKLWVQGLIAVWLIVALAL 317 Vibrio alginoly...
P27377       236 GDFFLRMSPVTVPVLICGLLTCLLVEKLRWFGYGETLPEKVREVLQQFDDQSRHQRTRQDKIRLIVQAIIGVWLVTALAL 315 Escherichia coli
WP_005693738 245 MEFFLRMAPVTIPVFICGLLTCFLVEKFKLFGYGEKLPDEVWKILSDLDRTNSEKMSKQDKIKLGMQALIAIWLIVGLAF 324 Haemophilus inf...
BAA12073     318 HLAAVGLIGLSVIILATSFTGVIEEHSMGKAFEEALPFTALLAVFFSIVAVIIDQELFKPVIDAVLAVEDKgTQLALFYV 397 Vibrio parahaem...
BAA12086     318 HLAAVGLIGLSVIILATAFTGVIEEHSMGKAFEEALPFTALLAVFFSIVAVIIDQELFKPVIDAVLAVEDKgTQLALFYV 397 Vibrio alginoly...
P27377       316 HLAEVGLIGLSVIILATSLTGVTDEHAIGKAFTESLPFTALLTVFFSVVAVIIDQQLFSPIIQFVLQASEH-AQLSLFYI 394 Escherichia coli
WP_005693738 325 HLAAVGLIGLSIIIFATSFTGVTDEHTIGKAFQESLPFTALLVVFFSVVAVIIDQKLFSPIIHFVLSAEEN-TQLALFYL 403 Haemophilus inf...
BAA12073     398 ANGLLSMVSDNVFVGTVYINEVKSALMEGLITREQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLSYGRM 477 Vibrio parahaem...
BAA12086     398 ANGLLSMVSDNVFVGTVYINEVKTALIEGLITREQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLSYGRM 477 Vibrio alginoly...
P27377       395 FNGLLSSISDNVFVGTIYINEAKAAMESGAITLKQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLSYGRM 474 Escherichia coli
WP_005693738 404 FNGLLSSISDNVFVATVYINEAKAALTNGVIAPHQFELLSVAINTGTNLPSVATPNGQAAFLFLLTSSISPLIRLSYGRM 483 Haemophilus inf...
BAA12073     478 VVMALPYTVVLAIVGLMGIMFFLEPATASFYDAGWIAPH 516 Vibrio parahaemolyticus
BAA12086     478 VIMALPYTIVLAIVGLMGIMFFLEPATASFYDAGWILPH 516 Vibrio alginolyticus
P27377       475 VWMALPYTLVLTLVGLLCVEFTLAPVTEWFMQMGWIATL 513 Escherichia coli
WP_005693738 484 VYMALPYTIVLSIIGLLAIEFILPAATIWLASLGLILPI 522 Haemophilus influenzae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap