Conserved Protein Domain Family
DcuC

?
TIGR00771: DcuC 
c4-dicarboxylate anaerobic carrier family protein
These proteins are members of the C4-dicarboxylate Uptake C (DcuC) Family (TC 2.A.61). The only functionally characterized member of this family is the anaerobic C4-dicarboxylate transporter (DcuC) of Escherichia coli. DcuC has 12 GES predicted transmembrane regions, is induced only under anaerobic conditions, and is not repressed by glucose. It may therefore function as a succinate efflux system during anaerobic glucose fermentation. However, when overexpressed, it can replace either DcuA or DcuB in catalyzing fumarate-succinate exchange and fumarate uptake. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129854
View PSSM: TIGR00771
Aligned: 3 rows
Threshold Bit Score: 321.466
Threshold Setting Gi: 1175266
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P45428  55 GYLIVDIYNEILRMLSNRIAGLGLSIMAVGGYARYMERIGASRAMVSLLSRPLKLIRSPYIILSATYVIGQIMAQFITSA 134 Escherichia coli K-12
Q47134  58 GYSATDIVEYVKILLMSRGGDLGMMIMMLCGFAAYMTHIGANDMVVKLASKPLQYINSPYLLMIAAYFVACLMSLAVSSA 137 Escherichia coli
P44018     --------------------------------------------------------------------------------     Haemophilus influenza...
P45428 135 SGLGMLLMVTLFPTLVSLGVSRLSAVAVIATTMSIEWGILETNSIFAAQVAGMKIATYFFHYQLPVASCVIISVAISHFF 214 Escherichia coli K-12
Q47134 138 TGLGVLLMATLFPVMVNVGISRGAAAAICASPAAIILAPTSGDVVLAAQASEMSLIDFAFKTTLPISIAAIIGMAIAHFF 217 Escherichia coli
P44018   1 ----------------------------MMSPGSSHSAMISEMSGLTITQVNLSHAPYN---MIAGAIGAVVLTILALVF 49  Haemophilus influenza...
P45428 215 VQRAFDKKDkNINHEQAEQKALDNVPPLYYAILPVMPLILMLgsLFLAHVGlmqSELHLVVVMLLSLTVTMFVEFFRKHN 294 Escherichia coli K-12
Q47134 218 WQRYLDKKE-HISHEMLDVSEITTTAPAFYAILPFTPIIGVL--IFDGKWG---PQLHIITILVICMLIASILEFLRSFN 291 Escherichia coli
P44018  50 KDYGEQHRQaYLAEQKESEIKVIEGVNVLYALAPLIPLVILV----IGGTSlqqVPGLEWTKMGVPQAMLIGAIYGIIVT 125 Haemophilus influenza...
P45428 295 LRETMDDVQAFFDGMGTQFANVVTLVVAGEIFAKGLTTIGTVDAVIRGAEHSGLGGIGVMIIMALVIAICAIVMGSGNAP 374 Escherichia coli K-12
Q47134 292 TQKVFSGLEVAYRGMADAFANVVMLLVAAGVFAQGLSTIGFIQSLISIATSFGSASIILMLVLVILTMLAAVTTGSGNAP 371 Escherichia coli
P44018 126 RISPVKITEEFFNGMGNSYANVLGIIIAASVFVAGLKSTGAVDAAISFLKES---NEFVRWGATIGPFLMGLITGSGDAA 202 Haemophilus influenza...
P45428 375 FMSFASLIPNIAAGLHVPAVVMIMPMHFATTLARAVSPITAVVVVTSGIAGVSPFAVVKRTAIPMAVGFV 444 Escherichia coli K-12
Q47134 372 FYAFVEMIPKLAHSSGINPAYLTIPMLQASNLGRTLSPVSGVVVAVAGMAKISPFEVVKRTSVPVLVGLV 441 Escherichia coli
P44018 203 AIAFNTAVTPHAVELGYTHVNLGMAAAIAGAIGRTASPIAGVTIVCAGLAMVSPVEMVKRTAPGMILAVL 272 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap