1PVO


Conserved Protein Domain Family
rho

?
TIGR00767: rho 
Click on image for an interactive view with Cn3D
transcription termination factor Rho
This RNA helicase, the transcription termination factor Rho, occurs in nearly all bacteria but is missing from the Cyanobacteria, the Mollicutes (Mycoplasmas), and various Lactobacillales including Streptococcus. It is also missing, of course, from the Archaea, which also lack Nus factors. Members of this family from Micrococcus luteus, Mycobacterium tuberculosis, and related species have a related but highly variable long, highly charged insert near the amino end. Members of this family differ in the specificity of RNA binding. [Transcription, Transcription factors]
Statistics
?
PSSM-Id: 162030
View PSSM: TIGR00767
Aligned: 12 rows
Threshold Bit Score: 669.857
Threshold Setting Gi: 1710260
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1PVO_A         1 MNLTELKNTPVSELITLG-ENMGLEN--LARMRKQDIIFAILKQHAKS-GEDIFGD------------------------ 52  Escherichia coli
P03002         1 MNLTELKNTPVSELITLG-ENMGLEN--LARMRKQDIIFAILKQHAKS-GEDIFGD------------------------ 52  Escherichia coli
P44619         1 MHLTELKNTPVSDLVKLGeEQMGLEN--LARLRKQDIVFAILKQHAKS-GEDIFGG------------------------ 53  Haemophilus inf...
P33561        97 VEIEKLYDKPITEVRKIV-EGLGTNHtiAVTMKKTELIFLLVKILSEN-NIDVLFT------------------------ 150 Borrelia burgdo...
O83281        98 LLIDDLTEMGMHALRDFA-VQRGISQedVVVMKKSDIIFHVLKNHTEN-GGVIFAS------------------------ 151 Treponema palli...
Q10607        32 EPAGSLATMVLPELRALA-NRAGVKG--TSGMRKNELIAAIEEIRRQA-NGAPAVDrsaqehdkgdrppsseapatqgeq 107 Mycobacterium t...
O67031        18 YSREELKQKTLAELQKIG-KELGLTR--TTGLKKEELIEKILKAQLEK-SRLVFVK------------------------ 69  Aquifex aeolicu...
Q03222         4 VSISSLENMKLKELYELA-RHYKISY--YSKLTKKELIFAILKANAEQ-EDLLFME------------------------ 55  Bacillus subtil...
P56466        23 YHIEDLRTYPTEKLLEIA-NKLKVEN--PQEFKRQDLMFEILKTQVTQ-GGYILFT------------------------ 74  Helicobacter py...
Q9ZD24        30 INLKQLKRKLPEELQVQA-EELKIEN--ISSLLKQELVFAILKKSVEQ-GGLIVGE------------------------ 81  Rickettsia prow...
WP_010883248  49 TKIAKLQRMGIEELNILA-RQYGVKN--IGSLTKSQVVFEIVKAKSERpDELLIGE------------------------ 101 Chlamydia pneum...
WP_009871853  49 TKIAKLQRMGINELNVLA-RQYGVKN--VGSLTKSQVVFEIVKAKSERpDEFLIGE------------------------ 101 Chlamydia trach...
1PVO_A           --------------------------------------------------------------------------------     Escherichia coli
P03002           --------------------------------------------------------------------------------     Escherichia coli
P44619           --------------------------------------------------------------------------------     Haemophilus inf...
P33561           --------------------------------------------------------------------------------     Borrelia burgdo...
O83281           --------------------------------------------------------------------------------     Treponema palli...
Q10607       108 tpteqidsqsqqvrperrsatreagpsgsgeragtaaddtdnrqggqqdakteergtdaggdqggdqqasggqqargded 187 Mycobacterium t...
O67031           --------------------------------------------------------------------------------     Aquifex aeolicu...
Q03222           --------------------------------------------------------------------------------     Bacillus subtil...
P56466           --------------------------------------------------------------------------------     Helicobacter py...
Q9ZD24           --------------------------------------------------------------------------------     Rickettsia prow...
WP_010883248     --------------------------------------------------------------------------------     Chlamydia pneum...
WP_009871853     --------------------------------------------------------------------------------     Chlamydia trach...
1PVO_A        53 ----------------------------------------GVLEILQ-DGFGFLRSADSSYLAGPDDIYVSPSQIRRFNL 91  Escherichia coli
P03002        53 ----------------------------------------GVLEILQ-DGFGFLRSADSSYLAGPDDIYVSPSQIRRFNL 91  Escherichia coli
P44619        54 ----------------------------------------GVLEILP-DGFGFLRSADSSYLAGPDDIYVSPSQIRRFNL 92  Haemophilus inf...
P33561       151 ----------------------------------------GVLDVLS-DGYGFLRTASNSYLSGGNDVYVSPSQIRLFNL 189 Borrelia burgdo...
O83281       152 ----------------------------------------GSLEILP-DGYGFLRSPQNSYLPGSDDIYVSPSQIRLFNL 190 Treponema palli...
Q10607       188 gearqgrrgrrfrdrrrrgersgdgaeaelreddvvqpvaGILDVL--DNYAFVRT--SGYLPGPHDVYVSMNMVRKNGM 263 Mycobacterium t...
O67031        70 ----------------------------------------GVLEILP-EGYGFLRMPENNYMPSWNDVYVAPSQIKKFGL 108 Aquifex aeolicu...
Q03222        56 ----------------------------------------GVLEIIQsEGFGFLR--PINYSPSSEDIYISASQIRRFDL 93  Bacillus subtil...
P56466        75 ----------------------------------------GILEIMP-DGYGFLRGFDGSFSDGHNDTYVSPSQIRRFAL 113 Helicobacter py...
Q9ZD24        82 ----------------------------------------GVLEVLP-DGFGFLRSPEVNYLAGPDDIYISPSQIRRFGL 120 Rickettsia prow...
WP_010883248 102 ----------------------------------------GVLEVLP-DGFGFLRSPTYNYLPSAEDIYVSPAQIRRFDL 140 Chlamydia pneum...
WP_009871853 102 ----------------------------------------GVLEVLP-DGFGFLRSPTYNYLPSAEDIYVSPAQIRRFDL 140 Chlamydia trach...
1PVO_A        92 RTGDTISGKIRPPKEGE------RYFALLKVNEVNFDKPENA--RNKILFENLTPLHANSRLRMErg--nGSTEDLTARV 161 Escherichia coli
P03002        92 RTGDTISGKIRPPKEGE------RYFALLKVNEVNFDKPENA--RNKILFENLTPLHANSRLRMErg--nGSTEDLTARV 161 Escherichia coli
P44619        93 QTGDKIEGKIRPPKEGE------RYFALLKVDQVNDDKPEVS--RSKILFENLTPLHANSRLRMErg--nGSTEDLTARI 162 Haemophilus inf...
P33561       190 RTGDILYGQIRSPRDGE------RFFAMVKIKSINDQDPTFA--QNRIPFDNLTPLYPNVKLNLE-----YENCNISTRL 256 Borrelia burgdo...
O83281       191 KTGDTIYGQIRSPKEGE------RFFAMLRVETVNFEEVAKV--QDRVPFDSLTPLYPREKLNLE-----TRTEDISTRV 257 Treponema palli...
Q10607       264 RRGDAVTGAVRVPKEGEqpnqrqKFNPLVRLDSINGGSVEDA--KKRPEFGKLTPLYPNQRLRLE-----TSTERLTTRV 336 Mycobacterium t...
O67031       109 RTGDTIEGFARLPRENE------KYKALIRMESVNGLPPDPEilKRRPQFEKLTPLHPMERFKLE-----YDPNELSTRV 177 Aquifex aeolicu...
Q03222        94 RNGDKVSGKVRPPKENE------RYYGLLHVEAVNGDDPESA--KERVHFPALTPLYPDRQMVLE-----TKPNFLSTRI 160 Bacillus subtil...
P56466       114 RNGDIVTGQVRSPKDQE------KYYALLKIEAINYSPSDEI--RNRPLFDNLTPLFPDEQIKLE-----YEPTKVTGRM 180 Helicobacter py...
Q9ZD24       121 RTGDTVEGQIRAPKAGE------RYFALLKVNRVNFEDPAKA--YHRVHFDNLTPLYPDEKLGLElennsKDSKDFSTRV 192 Rickettsia prow...
WP_010883248 141 KKGDTIIGTIRSPKEKE------KYFALLKVDKINGSTPDKA--KERVLFENLTPLYPNQRIVME-----MGKDHLAERV 207 Chlamydia pneum...
WP_009871853 141 KKGDTIVGTIRSPKEKE------KYFALLKVDKINGSTPDKA--KERVLFENLTPLHPNERLIME-----MGKENLAERV 207 Chlamydia trach...
1PVO_A       162 LDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLV--KGEVVASTFDEPASRH 239 Escherichia coli
P03002       162 LDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLV--KGEVVASTFDEPASRH 239 Escherichia coli
P44619       163 LDLASPIGKGQRGLIVAPPKAGKTMLLQNIAQSITHNYPDVELIVLLIDERPEEVTEMQRSV--KGEVIASTFDEPATRH 240 Haemophilus inf...
P33561       257 INLFSPIGKGQRALIVSPPKAGKTTLLQKIANAITTNYSDVILMILLIDERPEEVTDMIRSV--KGEVIASNFDEQASRH 334 Borrelia burgdo...
O83281       258 MNLFCPIGKGQRALIVAPPRTGKTILMQKIANAITQNHPEVYLIVLLIDERPEEVTDMERTV--DAEVISSTFDEQATRH 335 Treponema palli...
Q10607       337 IDLIMPIGKGQRALIVSPPKAGKTTILQDIANAITRNNPECHLMVVLVDERPEEVTDMQRSV--KGEVIASTFDRPPSDH 414 Mycobacterium t...
O67031       178 VSLIAPIGKGQRGLIVAPPKAGKTVLLQKIAQAIIRNHPEVYLIILLIDERPEEVTEMRRIVkdKAEVVASTFDEPPERH 257 Aquifex aeolicu...
Q03222       161 MDMMAPVGFGQRGLIVAPPKAGKTMLLKEIANSITANQPEAELIVLLIDERPEEVTDIERSV--AGDVVSSTFDEVPENH 238 Bacillus subtil...
P56466       181 LDLFSPVGKGQRALIVAPPRTGKTELMKELAQGITSNHPEVELIILLVDERPEEVTDMQRSV--KGQVFSSTFDLPANNH 258 Helicobacter py...
Q9ZD24       193 IELVAPMGKGQRALIVAPPRTGKTVLLQNIAHAITTNNPEVFLIVLLIDERPEEVTDMQRSV--RGEVVSSTFDEPASRH 270 Rickettsia prow...
WP_010883248 208 LDLTAPIGKGQRGLIVAPPRSGKTVILQSIAHAIAVNNPDIVLIVLLIDERPEEVTDMIRQV--RGEVVASTFDEQPERH 285 Chlamydia pneum...
WP_009871853 208 LDLTAPIGKGQRGLIVAPPRSGKTVILQSIAHAIAVNNPDAELIVLLIDERPEEVTDMIRQV--RGEVVASTFDEQPDRH 285 Chlamydia trach...
1PVO_A       240 VQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATA 319 Escherichia coli
P03002       240 VQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATA 319 Escherichia coli
P44619       241 VQVAEMVIEKAKRSVEHKKDVVILLDSITRLARAYNTVTPASGKILSGGVDANALHRPKRFFGAARNVEEGGSLTIIATA 320 Haemophilus inf...
P33561       335 VQVAEMVIEKAKRLVENKKDVVILLDSITRLARAYNQTMPTSGKILSGGVDSNALHKPKRFFGSARNIEEGGSLTIIATA 414 Borrelia burgdo...
O83281       336 VQIAEIVLERAKRLVEHRKDVVILLDSITRLARAYNQTMPTSGKVLSGGVDSNALHKPKRFFGAARNVEEGGSLTIIATA 415 Treponema palli...
Q10607       415 TSVAELAIERAKRLVEQGKDVVVLLDSITRLGRAYNNASPASGRILSGGVDSTALYPPKRFLGAARNIEEGGSLTIIATA 494 Mycobacterium t...
O67031       258 MQVAEIVVEKAKRMVELKKDVVILMDSLTRFTRASNAVTPPTGRVLTGGIEITAFQRPKKFFGAARNIEEGGSLTIIATA 337 Aquifex aeolicu...
Q03222       239 IKVAELVLERAMRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARNIEEGGSLTILATA 318 Bacillus subtil...
P56466       259 IRIAELVLERAKRRVEMGKDVVVLLDSITRLARAYNAVTPSSGKVLSGGVDANALHRPKRFFGAARNIEEGGSLTIIATA 338 Helicobacter py...
Q9ZD24       271 VQLAEMVIEKAKRLVEHKKDVVILVDAITRLARAYNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIENGGSLTIIGTA 350 Rickettsia prow...
WP_010883248 286 IQVAEMVIEKARRLVEHGNDVVILLDSITRLARAYNTVQPHSGKILTGGVDASALHKPKRFFGAARNIEGGGSLTILATA 365 Chlamydia pneum...
WP_009871853 286 IQVTEMVIEKARRLVEHGKDVVILLDSITRLARAYNTVQPHSGKILTGGVDASALHKPKRFFGAARNIEGGGSLTILATA 365 Chlamydia trach...
1PVO_A       320 LIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFL 399 Escherichia coli
P03002       320 LIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFL 399 Escherichia coli
P44619       321 LVDTGSKMDEVIFEEFKGTGNMELHLSRKIAERRVFPAIDFKRSGTRKEDLLTTADELQKMWILRKILNPMDEVDAMEFL 400 Haemophilus inf...
P33561       415 LVDTGSKMDEVIFEEFKSTGNMELILDRSLADRRLFPAINIKKSGTRKEELLLSEEERSKILLIRRILGGVDDYEGVEVL 494 Borrelia burgdo...
O83281       416 LIETGSRMDEVIFEEFKGTGNMEINLDRRLSDRRLFPAVSIKKSGTRKEELLLTEEEMQRIWVLRKVINPMDDAEIVELL 495 Treponema palli...
Q10607       495 MVETGSTGDTVIFEEFKGTGNAELKLDRKIAERRVFPAVDVNPSGTRKDELLLSPDEFAIVHKLRRVLSGLDSHQAIDLL 574 Mycobacterium t...
O67031       338 LVETGSKMDDVIYEEFKGTGNMEIHLDRRLMERRIFPAINIEKSGTRKEELLLEPWELQRIWVLRKFLSTMDPVEAMEFL 417 Aquifex aeolicu...
Q03222       319 LVDTGSRMDDVIYEEFKGTGNMELHLDRSLAERRIFPAIDIRRSGTRKEELLVPKEHLDRLWSIRKTMS--DSPDFAEKF 396 Bacillus subtil...
P56466       339 LIETGSRMDEVIFEEFKGTGNSEIVLARNIADRRIYPAFDILKSGTRKDNILLGKDRLTKVWVLRNVMQQMDDIEALSFV 418 Helicobacter py...
Q9ZD24       351 LIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKRIYPAIDITRSGTRKEDLLVDKIILNKMWVLRRIIDPMGSSEAIEFL 430 Rickettsia prow...
WP_010883248 366 LIDTGSRMDEVIFEEFKGTGNMELVLDRRLSDRRTYPAIDLIKSGTRKEELLYHPSELERVYLFRQAIADLTTIDAMHLL 445 Chlamydia pneum...
WP_009871853 366 LIDTGSRMDEVIFEEFKGTGNMELVLDRHLSDRRIYPAIDLIKSGTRKEELLYHPGELEKIRLFRQAIAGLTAIDAMHLL 445 Chlamydia trach...
1PVO_A       400 INKLAMTKTNDDFFEMMKR 418 Escherichia coli
P03002       400 INKLAMTKTNDDFFEMMKR 418 Escherichia coli
P44619       401 IDKLMMAKTNEEFFEVMKR 419 Haemophilus influenzae Rd KW20
P33561       495 IEKMKKSKNNEIFLKTMSN 513 Borrelia burgdorferi B31
O83281       496 IDKMRKTKNNEAFLRSMNT 514 Treponema pallidum subsp. pallidum str. Nichols
Q10607       575 MSQLRKTKNNYEFLVQVSK 593 Mycobacterium tuberculosis
O67031       418 LEKLRRFKTNEEFLKAMNA 436 Aquifex aeolicus VF5
Q03222       397 MRKMKKTKTNQEFFDILNQ 415 Bacillus subtilis subsp. subtilis str. 168
P56466       419 YSKMQQTKDNEEFLNLMNE 437 Helicobacter pylori 26695
Q9ZD24       431 LKKLENTKTNCAFFEMMKS 449 Rickettsia prowazekii str. Madrid E
WP_010883248 446 LGRLKKTNSNAEFLLSLKE 464 Chlamydia pneumoniae
WP_009871853 446 LGRLKKTNSNTEFLLSLKD 464 Chlamydia trachomatis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap