1JDI


Conserved Protein Domain Family
araD

?
TIGR00760: araD 
Click on image for an interactive view with Cn3D
L-ribulose-5-phosphate 4-epimerase
E. coli has two genes, sgaE and sgbE (YiaS), that are very close homologs of araD, the established L-ribulose-5-phosphate 4-epimerase of E. coli. SgbE, part of an operon for L-xylulose metabolism, also has L-ribulose-5-phosphate 4-epimerase activity; L-xylulose-5-phosphate may be converted into L-ribulose-5-phosphate by another product of that operon. The homolog to this family from Mycobacterium smegmatis is flanked by putative araB and araA genes, consistent with it also being araD. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 129843
View PSSM: TIGR00760
Aligned: 7 rows
Threshold Bit Score: 439.647
Threshold Setting Gi: 2492917
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JDI_A   1 MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDRERGVFVIKPSGVDYSIMTADDMVVVSIEtGEVVEGAKKPSSDTPTH 80  Escherichia coli UMNK88
Q9S469   1 MLEELKQAVLEANLQLPQYRLVTFTWGNVSGIDRERGLVVIKPSGVAYDKLTIDDMVVVDLT-GNVVEGDLKPSSDTPTH 79  Geobacillus stearothe...
Q9KBQ4   1 MLEQLKETVFKANLYLPKYQLVTFTWGNVSGIDREKGLVVIKPSGVEYFEMKSKDMVVVDLE-GNIVEGDLKPSSDTPTH 79  Bacillus halodurans C...
P37680   1 MLEQLKADVLAANLALPAHHLVTFTWGNVSAVDETRQWMVIKPSGVEYDVMTADDMVVVEIAsGKVVEGSKKPSSDTPTH 80  Escherichia coli K-12
P08203   1 MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDRERGVFVIKPSGVDYSVMTADDMVVVSIEtGEVVEGTKKPSSDTPTH 80  Escherichia coli K-12
P94525   1 MLETLKKEVLAANLKLQEHQLVTFTWGNVSGIDREKERIVIKPSGVEYSDLTADDLVVLNLD-GEVVEGSLKPSSDTPTH 79  Bacillus subtilis sub...
P44989   1 MLAQLKKEVFEANLALPKHHLVTFTWGNVSAIDREKNLVVIKPSGVDYDVMTENDMVVVDLFtGNIVEGNKKPSSDTPTH 80  Haemophilus influenza...
1JDI_A  81 RLLYQAFPSIGGIVHTHSRHATIWAQAGQSIPATGTTHADYFYGTIPCTRKMTDAEINGEYEWETGNVIVETFEKQgiDA 160 Escherichia coli UMNK88
Q9S469  80 LWLYKQFPGIGGIVHTHSTWATVWAQAGKGIPALGTTHADYFYGEIPCTRPMTNEEIQGAYELETGKVITETFRFL--DP 157 Geobacillus stearothe...
Q9KBQ4  80 LALYRAFDKVGGIVHTHSVWATAWAQAGKEIPAYGTTHADYFHGTIPCTRPMTETEILGDYEKETGNVIVETFRNK--DP 157 Bacillus halodurans C...
P37680  81 LALYRRYAEIGGIVHTHSRHATIWSQAGLDLPAWGTTHADYFYGAIPCTRQMTAEEINGEYEYQTGEVIIETFEERgrSP 160 Escherichia coli K-12
P08203  81 RLLYQAFPSIGGIVHTHSRHATIWAQAGQSIPATGTTHADYFYGTIPCTRKMTDAEINGEYEWETGNVIVETFEKQgiDA 160 Escherichia coli K-12
P94525  80 VYLYKAFPNIGGIVHTHSQWATSWAQSGRDIPPLGTTHADYFDSAIPCTREMYDEEIIHDYELNTGKVIAETFQHH--NY 157 Bacillus subtilis sub...
P44989  81 LELYRQFPHIGGIVHTHSRHATIWAQAGLDIIEVGTTHGDYFYGTIPCTRQMTTKEIKGNYELETGKVIVETFLSRgiEP 160 Haemophilus influenza...
1JDI_A 161 AQMPGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIFCRQLAPQLPDMQQTLLNKHYLRKHGAKAYYGQ 231 Escherichia coli UMNK88
Q9S469 158 LQMPGVLVHGHGPFAWGKDPANAVHNAVVLEEVAKMAARTYMLNPNAKPISQTLLDRHYLRKHGANAYYGQ 228 Geobacillus stearothermophilus
Q9KBQ4 158 MSIPGVLVHSHAPFVWGKDPMEAVHHAVVLEEVAKMAQKTLSISERTLPMDSVLLDRHFYRKHGQAAYYGQ 228 Bacillus halodurans C-125
P37680 161 AQIPAVLVHSHGPFAWGKNAADAVHNAVVLEECAYMGLFSRQLAPQLPAMQNELLDKHYLRKHGANAYYGQ 231 Escherichia coli K-12
P08203 161 AQMPGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIFCRQLAPQLPDMQQTLLDKHYLRKHGAKAYYGQ 231 Escherichia coli K-12
P94525 158 EQVPGVLVNNHGPFCWGTDALNAIHNAVVLETVAEMAYHSIMLNKDVTPINTVLHEKHFYRKHGANAYYGQ 228 Bacillus subtilis subsp. subti...
P44989 161 DNIPAVLVHSHGPFAWGKDANNAVHNAVVLEEVAYMNLFSQQLNPYLSPMQKDLLDKHYLRKHGQNAYYGQ 231 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap