Conserved Protein Domain Family
UDG_fam4

?
TIGR00758: UDG_fam4 
uracil-DNA glycosylase, family 4
This well-conserved family of proteins is about 200 residues in length and homologous to the N-terminus of the DNA polymerase of phage SPO1 of Bacillus subtilis. The member from Thermus thermophilus HB8 is known to act as uracil-DNA glycosylase, an enzyme of DNA base excision repair. Its appearance as a domain of phage DNA polymerases could be consistent with uracil-DNA glycosylase activity. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129841
View PSSM: TIGR00758
Aligned: 6 rows
Threshold Bit Score: 290.087
Threshold Setting Gi: 499163915
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010865734  16 CTRCPLHATRTHAVPGEGPGEAGVMVVGEAPGRMEDRLGRPFVGPAGKLLDSLLE-LAGLSRG-EVYITNVVKCRPPGNR 93  Aeropyrum pernix
WP_010885553  21 CKKCPLWEVRTNPVPGDGSYDTKIMFVGEAPGYWEDQMGLPFVGKAGKVLDELLK-LIGLKRS-EVYITNIVKCRPPNNR 98  Pyrococcus hori...
WP_010879766  14 CRKCDLHKTKTNYVPGVGNEKAEIVFVGEAPGRDEDLKGEPFVGAAGKLLTEMLA-SIGLRRE-DVYITNVLKCRPPNNR 91  Archaeoglobus f...
WP_004599677  76 FNGCELKKFATNTVFGDGNPQANIMLIGEAPGNTEDLKGIPFCGESGNLLDNMLY-AIGISRN-NFYITNMVFWRPPANR 153 Rickettsia prow...
WP_010881101  22 CTRCDLHKSRTRVVPGDGNPYSLLVFVGEAPGEEEDRQGKPFVGRAGQLLNRLIEeVLGMKRE-DVYITNVCKCRPPQNR 100 Aquifex aeolicus
WP_010881677  99 CRACELYQRRTHAVVGEGVADADVLVVGEAPGAEEDRSGRPFVGRSGKLLDAMLA-AIGLSRQqNCYITNVVKCRPPRNR 177 Treponema pallidum
WP_010865734  94 DPREEEIEACLPYLVEQISLIRPRLVIAVGRHAGRTLFRLAglrwP----GLARARGRVWRGR--IGGVELLIAVTYHPA 167 Aeropyrum pernix
WP_010885553  99 DPTEEEIKACAPYLDAQIDIIKPKVIVTLGRFSTAYIMKKYgfnvE----PISKIHGRVFEAR--TLFGKIYIVPMYHPA 172 Pyrococcus hori...
WP_010879766  92 DPTPEEVEKCGDYLVRQLEAIRPNVIVCLGRFAAQFIFNLF----DleftTISRVKGKVYEVE--RWGKKVKVIAIYHPA 165 Archaeoglobus f...
WP_004599677 154 QPTLEEVDICRPFVEKHIALINPKLLILVGSTAATSLLGKN----A----CITKIRQEYYFYTnkYISTPIQTTAIFHPA 225 Rickettsia prow...
WP_010881101 101 KPTPIEMRACFPYLKKEIEIIQPKVICCLGATAGEGILGKS----L----RITKVRGQVFPYP--Y-NPRIKVFLTYHPA 169 Aquifex aeolicus
WP_010881677 178 TPTPHETACCARFLHAHLTLHRPCAILVLGRCAAQHMLQTT----D----GIGKLRGRFFTYQ--G----IPLLATYHPS 243 Treponema pallidum
WP_010865734 168 AALYNPGLRGELERDFSgfirrSVAEALSR 197 Aeropyrum pernix
WP_010885553 173 VALYRPQLRRELEEDFK-----KLKSLLSS 197 Pyrococcus horikoshii
WP_010879766 166 AVLYRPQLREEYESDFK-----KIGELCGK 190 Archaeoglobus fulgidus
WP_004599677 226 YLLRQPMQKRTSWYDLL-----KIKEYLVN 250 Rickettsia prowazekii
WP_010881101 170 YVLRNPKEETTIIKDFE-----KLKELLTQ 194 Aquifex aeolicus
WP_010881677 244 ALLRDEALKRPAWEDLKtf-raRLLQLKQD 272 Treponema pallidum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap