1BCF,3UOF


Conserved Protein Domain Family
bfr

?
TIGR00754: bfr 
Click on image for an interactive view with Cn3D
bacterioferritin
Bacterioferritin, predominantly an iron-storage protein restricted to Bacteria, has also been designated cytochrome b1 and cytochrome b-557.Bacterioferritin is a homomultimer most species. In Neisseria gonorrhoeae, Synechocystis PCC6803, Magnetospirillum magnetotacticum, and Pseudomonas aeruginosa, two types of subunit are found in a heteromultimeric complex, with each species having one member of each type. At present, both types of subunit are including in this single model. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 162022
View PSSM: TIGR00754
Aligned: 6 rows
Threshold Bit Score: 248.187
Threshold Setting Gi: 504219977
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1BCF_A         1 MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIG 80  Escherichia col...
AAF93538       1 MKGDPVIIQHLNKVLANELIAINQYFLHARMYKDWGLKHLADKEYHESIDEMKHADHIVERILFLEGIPNLQDLGKLMIG 80  Vibrio cholerae...
O08465         1 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQDNWGFTELAAHTRAESFDEMRHAEEITDRILLLDGLPNYQRIGSLRIG 80  Mycobacterium t...
WP_014407079   1 MEGNLEVRQHLNQALKLQLTAINQYFLHARMCKNWGLNALNQYEYKVSIKAMKQADSLIERVLFLEGLPNLQNLEKLLIG 80  Synechocystis s...
P11056         1 MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIG 80  Escherichia coli
3UOF_A         3 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQDNWGFTELAAHTRAESFDEMRHAEEITDRILLLDGLPNYQRIGSLRIG 82  Mycobacterium t...
1BCF_A        81 EDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREE 157 Escherichia coli K-12
AAF93538      81 EDVQEMLECDLKLELIAIPDLKEAIAYAEKVRDYVSRDLFQEILEDEEEHVDWLETQLGLIDMTGIQNYLQAQFVDD 157 Vibrio cholerae O1...
O08465        81 QTLREQFEADLAIEYDVLNRLKPGIVMCREKQDTTSAVLLEKIVADEEEHIDYLETQLELMDKLGEELYSAQCVSRP 157 Mycobacterium tube...
WP_014407079  81 ETVPEILGNDLTMNQGIRDGLVNSIAFFETQRDYVSRDVLSEILEETEEQIDWLESQQWLISNSGLENYLQSMMGEE 157 Synechocystis sp. ...
P11056        81 EDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREE 157 Escherichia coli
3UOF_A        83 QTLREQFEADLAIEYDVLNRLKPGIVMCREKQDTTSAVLLEKIVADEEEHIDYLETQLELMDKLGEELYSAQCVSRP 159 Mycobacterium tube...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap