Conserved Protein Domain Family
undec_PP_bacA

?
TIGR00753: undec_PP_bacA 
undecaprenyl-diphosphatase UppP
This is a family of small, highly hydrophobic proteins. Overexpression of this protein in Escherichia coli is associated with bacitracin resistance, and the protein was originally proposed to be an undecaprenol kinase and called bacA. It is now known to be an undecaprenyl pyrophosphate phosphatase (EC 3.6.1.27) and is renamed UppP. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
Statistics
?
PSSM-Id: 129836
View PSSM: TIGR00753
Aligned: 6 rows
Threshold Bit Score: 235.36
Threshold Setting Gi: 20140361
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P94507         9 AAILGIVEGLTEYAPVSSTGHMIIVDDIWLkssnlmSEEAANSFKVVIQLGSILAVAIVFKDRILNLLGLKKN--ITSDQ 86  Bacillus subtil...
P31054        10 AAILGVVEGLTEFLPVSSTGHMIIVGHLLGf-----EGDTAKTFEVVIQLGSILAVVVMFWRRLFGLIGIHFGrpLQHEG 84  Escherichia coli
O67939         6 AVVLGIVEGISEFLPISSTGHLILTAHILGi----kHTDFVKSFEISIQLGSILAVVVLYFNRLIRDYEIWKR------- 74  Aquifex aeolicu...
Q55684        56 AFVLGFIQGATEFLPISSTAHLKAVPMALG------WGDPGVAFTAVIQLGSIGAVFWYFWEDLTGIAKGIIKavQTRQY 129 Synechocystis s...
O51273         7 AIILGIIQGITEFLPISSSGHLLLFRHFIN-------LKLSIIFDIYLHLATVLVIIIYYRKRILELFLTFIRf-SLRKT 78  Borrelia burgdo...
WP_003899183  12 VIVLAAAQGLTEFLPVSSSGHLAIVSRIFF------SGDAGASFTAVSQLGTEAAVVIYFARDIVRILSAWLHglVVKAH 85  Mycobacterium t...
P94507        87 EQGHKLSIAQIAVGLVPAAVLGFLFEDYIDEy---LFS-VKTVAIGLIAGAILMLFADWVNkRKTATDTLDRISYKQAIA 162 Bacillus subtil...
P31054        85 ESKGRLTLIHILLGMIPAVVLGLLFHDTIKS----LFN-PINVMYALVVGGLLLIAAECLKpKEPRAPGLDDMTYRQAFM 159 Escherichia coli
O67939        75 ----------IIAAFIPTGIIGFLLYKLIKGf---LIGnDLVVVVSLILGGIILIFADTYCeKFCYLGDVRELPLRKAFM 141 Aquifex aeolicu...
Q55684       130 DSLEFKLGLGIGLGTIPIVFFGLLMKLLVQDldnsFFRsLSTIAIASIVMALLLALAEKLG---THRRPFEKLRWQDGLI 206 Synechocystis s...
O51273        79 VKSDLTNLKLILLILIITIVTGVVGTFISKY----ESMfTLSFVLINFIITGILILMLEFN---FLKVDFKGNILLAGIF 151 Borrelia burgdo...
WP_003899183  86 RNTDYRLGWYVIIGTIPICILGLFFKDDIRSg---VRN-LWVVVTALVVFSGVIALAEYVG-RQ--SRHIERLTWRDAVV 158 Mycobacterium t...
P94507       163 VGLFQCLSLWPGFSRSGSTISGGVILGLNHRAAADFTFIMAMPIMMGASFLSLVKHWDSLSSDLM---PFFIVGFICAFV 239 Bacillus subtil...
P31054       160 IGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTSGDI---PMFAVGFITAFV 236 Escherichia coli
O67939       142 IGVFQSIAVIPGVSRSGSTIIGGMLMGLNRKVAAEFSFLLAIPTMFAATTYDLIKSGGSFNAQEWn---ILIIGFITSFI 218 Aquifex aeolicu...
Q55684       207 MGTAQALALIPGVSRSGSTLTAGLFINLERAAAARFSFLLGIPAITIAGLVELKGLLDKNLSNDAi--LPLIVGTISSAV 284 Synechocystis s...
O51273       152 MGLMQGLGALPGISRSGITIFSASVIGFNRKSAFEISFLSLIPIVFGAILLKHKEFYDIFMVLNF---FEINLGALVAFV 228 Borrelia burgdo...
WP_003899183 159 VGIAQTLALVPGVSRSGSTISAGLFLGLDRELAARFGFLLAIPAVFASGLFSLPDAFHPVTEGMSatgPQLLVATLIAFV 238 Mycobacterium t...
P94507       240 VALFVVRFFLRLINKIKLVPFAIYRIILG 268 Bacillus subtilis subsp. subtilis str. 168
P31054       237 VALIAIKTFLQLIKRISFIPFAIYRFIVA 265 Escherichia coli
O67939       219 TALIVVKWFLNFLKSHSLKIFGFYRILIG 247 Aquifex aeolicus VF5
Q55684       285 FSYLAIAWLIKFLQKRSTWIFVWYRLIFG 313 Synechocystis sp. PCC 6803 substr. Kazusa
O51273       229 VGIFSINFFFKMLNNKKLYYFSIYLFALS 257 Borrelia burgdorferi B31
WP_003899183 239 LGLTAVAWLLRFLVRHNMYWFVGYRVLVG 267 Mycobacterium tuberculosis complex
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap