Conserved Protein Domain Family
menA

?
TIGR00751: menA 
1,4-dihydroxy-2-naphthoate octaprenyltransferase
This membrane-associated enzyme converts 1,4-dihydroxy-2-naphthoic acid (DHNA) to demethylmenaquinone, a step in menaquinone biosynthesis. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]
Statistics
?
PSSM-Id: 129834
View PSSM: TIGR00751
Aligned: 3 rows
Threshold Bit Score: 344.941
Threshold Setting Gi: 3183075
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P44739  19 RPKTLPLALASIFTGSALGYWANpqGFNGLVMVLCLLTTILLQVLSNFANDYGDHQKGSDTEERIGPLRGIQKGAISAKE 98  Haemophilus influenza...
P32166  17 RPKTLPLAFAAIIVGTALAWWQG--HFDPLVALLALITAGLLQILSNLANDYGDAVKGSDKPDRIGPLRGMQKGVITQQE 94  Escherichia coli K-12
O06400  12 RPRTLPNAIAPVVAGTGAAAWLH--AAVWWKALLALAVAVALVIGVNYANDYSDGIRGTD-DDRVGPVRLVGSRLATPRS 88  Mycobacterium tubercu...
P44739  99 LKWGLILMVMASFLSGSFLIGIAYENLSDLFAFAGLGILAIVAAITYTVGVKPYGYMGLGDISVLVFFGLLGVGGTYYLQ 178 Haemophilus influenza...
P32166  95 MKRALIITVVLICLSGLALVAVACHTLADFVGFLILGGLSIIAAITYTVGNRPYGYIGLGDISVLVFFGWLSVMGSWYLQ 174 Escherichia coli K-12
O06400  89 VLTAAMTSLALGALAGLVLALLSAP------WLIAVGAICIAGAWLYTGGSKPYGYAGFGELAVFVFFGPVAVLGTQYTQ 162 Mycobacterium tubercu...
P44739 179 THSIDSHIILPAIGSGLLASAVLNINNLRDIEQDAKAGKNTLAVRLGAYKGRVYHCILLSVAALCYLAFAVATAISWTNY 258 Haemophilus influenza...
P32166 175 AHTLIPALILPATACGLLATAVLNINNLRDINSDRENGKNTLVVRLGEVNARRYHACLLMGSLVCLALFNLFSLHSLWGW 254 Escherichia coli K-12
O06400 163 ALRVDWVGLAQAVATGALSCSVLVANNLRDIPTDARADKITLAVRLGDARTRMLYQGLLAVAGVLTFVLMLATP---WCV 239 Mycobacterium tubercu...
P44739 259 LFVLAMPLLAKHAIFVYCSQQPSELRPILAQMSMISLLINILFSLG 304 Haemophilus influenzae Rd KW20
P32166 255 LFLLAAPLLVKQARYVMREMDPVAMRPMLERTVKGALLTNLLFVLG 300 Escherichia coli K-12
O06400 240 VGLVAAPLALRAAGPVRSGRGGRELIPVLRDTGLAMLVWALAVAGA 285 Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap