2P67,3MD0


Conserved Protein Domain Family
lao

?
TIGR00750: lao 
Click on image for an interactive view with Cn3D
LAO/AO transport system ATPase
In E. coli, mutation of this kinase blocks phosphorylation of two transporter system periplasmic binding proteins and consequently inhibits those transporters. This kinase is also found in Gram-positive bacteria, archaea, and the roundworm C. elegans. It may have a more general, but still unknown function. Mutations have also been found that do not phosphorylate the periplasmic binding proteins, yet still allow transport. The ATPase activity of this protein seems to be necessary, however. [Transport and binding proteins, Amino acids, peptides and amines, Regulatory functions, Protein interactions]
Statistics
?
PSSM-Id: 129833
View PSSM: TIGR00750
Aligned: 7 rows
Threshold Bit Score: 449.994
Threshold Setting Gi: 3915402
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2P67_A        19 GERATLAQAMTLVESRHPRhqalSTQLLDAIM----PYCGNTLRLGVTGTPGAGKSTFLEAFGMLLIREGLKVAVIAVDP 94  Escherichia col...
O28980        13 GNRRALARAITYVENEYPE----SKEIMRQIF----AKTGRAHVVGLTGFPGVGKSTLVSKLTEEFRRRGKKVGIIAIDP 84  Archaeoglobus f...
O58012        14 GDRRAVAKLITLVENDESK----AKVIIKKIY----PLTGNAHIVGITGPPGAGKSTLLDKLIKEARREGLIVGVIAVDP 85  Pyrococcus hori...
P71777        21 GDRAALPRAITLVESTRPDhreqAQQLLLRLL----PDSGNAHRVGITGVPGVGKSTAIEALGMHLIERGHRVAVLAVDP 96  Mycobacterium t...
WP_010866525  14 GNLRALGRLLTLVENPGSE----AVELLERLS----SRAGRAQVIGFTGIPGAGKSTLVSRVITGLRRRGYRVAVVAIDP 85  Aeropyrum pernix
P27254        17 GERATLAQAMTLVESRHPRhqalSTQLLDAIM----PYCGNTLRLGVTGTPGAGKSTFLEAFGMLLIREGLKVAVIAVDP 92  Escherichia col...
3MD0_A        42 GDRAALPRAITLVESTRPD----HREQAQQLLlrllPDSGNAHRVGITGVPGVGKSTAIEALGMHLIERGHRVAVLAVDP 117 Mycobacterium t...
2P67_A        95 SSPVTGGSILGDKTRMNDLA------RAEAAFIRPVPSSGHLGGASQRARELMLLCEAAGYDVVIVETVGVGQSETEVAR 168 Escherichia col...
O28980        85 GSPFTGGALLGDRLRLDGMDsrkqlwTDPGIFFRSMSSRGRAGGLAAKTGDVVRLLDAFGFDVILVETVGAGQSEVDIIE 164 Archaeoglobus f...
O58012        86 TSPFTGGALLGDRIRMQRHS------TDPGVFIRSMATRGSLGGLSKATNDAIKILDAYGCDVIFVETVGVGQIEVDIVK 159 Pyrococcus hori...
P71777        97 SSTRTGGSILGDKTRMARLA------VHPNAYIRPSPTSGTLGGVTRATRETVVLLEAAGFDVILIETVGVGQSEVAVAN 170 Mycobacterium t...
WP_010866525  86 TSPFSGGSIMGDRLRMQEHA------ADPGVFIRSIPTRGIKGGLSMAALAMIEVFDAMGYDKIIIETVGVGQSEVDIIN 159 Aeropyrum pernix
P27254        93 SSPVTGGSILGDKTRMNDLA------RAEAAFIRPVPSSGHLGGASQRARELMLLCEAAGYDVVIVETVGVGQSETEVAR 166 Escherichia col...
3MD0_A       118 SSTRTGGSILGDKTRMARLA------VHPNAYIRPSPTSGTLGGVTRATRETVVLLEAAGFDVILIETVGVGQSEVAVAN 191 Mycobacterium t...
2P67_A       169 MVDCFISLQIAGGGDDLQGIKKGLMEVADLIVINKDDGDNHTN-VAIARHMYESALH-------------------ILRR 228 Escherichia col...
O28980       165 VADTSVVVMMPETGDEIQVNKAGILEIGDIYVVNKADLGGAEKvERWLRYMLSLDEEsvqmlsqmthadearvqsgEFFE 244 Archaeoglobus f...
O58012       160 TADTVVLVTIPGLGDDVQTIKAGLMEIADIFVVNKADREGAD--ITYFELTLALDLEk------------------EKWE 219 Pyrococcus hori...
P71777       171 MVDTFVLLTLARTGDQLQGIKKGVLELADIVVVNKADGEHHKE-ARLAARELSAAIR-------------------LIYP 230 Mycobacterium t...
WP_010866525 160 AAHTIIVVTMPGAGDDVQALKAGVMEIGDIYVVNKSDKPEAN--KTAAYLQFALEKE-------------------DIGR 218 Aeropyrum pernix
P27254       167 MVDCFISLQIAGGGDDLQGIKKGLMEVADLIVINKDDGDNHTN-VAIARHMYESALH-------------------ILRR 226 Escherichia col...
3MD0_A       192 MVDTFVLLTLARTGDQLQGIKKGVLELADIVVVNKADGEHHKE-ARLAARELSAAIR-------------------LIYP 251 Mycobacterium t...
2P67_A       229 KYDEWQPRVLTCSALEKRGIDEIWHAIIDFKTALTASGRLQQVRQQQSVEWLRKQTEEEVLNHLFANEdfdrYYRQTLLA 308 Escherichia col...
O28980       245 RRKGWNPPVIKTVADRGEGIKELADAIEEHFDYMKKTGLIEKRRRERVKRELFEIVMNDVIKLVKEKT----NYRDLLVK 320 Archaeoglobus f...
O58012       220 K-IGWKPPIIETVGTTGKGVKELWEKIKEHKKFLEESGKLAEKRRTRIEEEVKTIIAGIVAKKVEASLs---EFEDIISM 295 Pyrococcus hori...
P71777       231 REALWRPPVLTMSAVEGRGLAELWDTVERHRQVLTGAGEFDARRRDQQVDWTWQLVRDAVLDRVWSNPtvrkVRSELERR 310 Mycobacterium t...
WP_010866525 219 RESGWRPKLVKTSAVLGQGIDPLVDAIEEHWRFARNTGLHTEKVKARRLLLAKMLAESLLSSKVSAAMe---VHRTLLEE 295 Aeropyrum pernix
P27254       227 KYDEWQPRVLTCSALEKRGIDEIWHAIIDFKTALTASGRLQQVRQQQSVEWLRKQTEEEVLNHLFANEdfdrYYRQTLLA 306 Escherichia col...
3MD0_A       252 REALWRPPVLTMSAVEGRGLAELWDTVERHRQVLTGAGEFDARRRDQQVDWTWQLVRDAVLDRVWSNPtvrkVRSELERR 331 Mycobacterium t...
2P67_A       309 VKNNTLSPRTGLRQLSE 325 Escherichia coli K-12
O28980       321 LLKGETDPYTAAEQIVE 337 Archaeoglobus fulgidus DSM 4304
O58012       296 VLNKDLDPYSAADLVLE 312 Pyrococcus horikoshii OT3
P71777       311 VRAGELTPALAAQQILE 327 Mycobacterium tuberculosis
WP_010866525 296 AAASGKGLFRAAEVVAR 312 Aeropyrum pernix
P27254       307 VKNNTLSPRTGLRQLSE 323 Escherichia coli K-12
3MD0_A       332 VRAGELTPALAAQQILE 348 Mycobacterium tuberculosis H37Rv
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap