1Q18


Conserved Protein Domain Family
glk

?
TIGR00749: glk 
Click on image for an interactive view with Cn3D
glucokinase, proteobacterial type
This model represents glucokinase of E. coli and close homologs, mostly from other proteobacteria, presumed to have equivalent function. This glucokinase is more closely related to a number of uncharacterized paralogs than to the glucokinase glcK (fromerly yqgR) of Bacillus subtilis and its closest homologs, so the two sets are represented by separate models. [Energy metabolism, Glycolysis/gluconeogenesis]
Statistics
?
PSSM-Id: 129832
View PSSM: TIGR00749
Aligned: 4 rows
Threshold Bit Score: 506.728
Threshold Setting Gi: 20138118
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Q18_A  17 LVGDVGGTNARLALC---DIASGEISQA----KTYSGLDYPSLEAVIRVYLEEHKVEVKD------GCIAIACPITGDWV 83  Escherichia coli
P46880   6 LVGDVGGTNARLALC---DIASGEISQA----KTYSGLDYPSLEAVIRVYLEEHKVEVKD------GCIAIACPITGDWV 72  Escherichia coli
O25731  10 LLADIGGTNARFGL----EVAPRQIECI----EVLRCEDFESLSDAVRFYLSKCKESLKLhp--iyGSFAVATPIMGDFV 79  Helicobacter pylori 2...
Q55855   9 LAGDIGGTKTILALVtinESSPGLARPVtlfeQTYSSPAFPDLVPMVQQFRQEAAFVLGNpisvakACFAIAGPVIDNTC 88  Synechocystis sp. PCC...
1Q18_A  84 AXTNHTWAFSIAEXKKNLGFSHLEIINDFTAVSXAIPXLKKEHLIQFGGAEPVEGKPIAVYGAGTGLGVAHLVH-VDKRW 162 Escherichia coli
P46880  73 AMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAEPVEGKPIAVYGAGTGLGVAHLVH-VDKRW 151 Escherichia coli
O25731  80 QMTNNHWTFSIETTRQCLTLKKLLVINDFVAQAYAISAMQENDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQnSDGSL 159 Helicobacter pylori 2...
Q55855  89 RLTNLDWHLSGDRLAQELAIAQVDLINDFAAVGYGILGLGSEDLTVLQAAPVDPSGAIAILGAGTGLGQCYVIPqGQGRY 168 Synechocystis sp. PCC...
1Q18_A 163 VSLPGEGGHVDFAPNSEEEAIILEILRAEI--GHVSAERVLSGPGLVNLYRAIVKAD--------NRLP-ENLKPKD--- 228 Escherichia coli
P46880 152 VSLPGEGGHVDFAPNSEEEAIILEILRAEI--GHVSAERVLSGPGLVNLYRAIVKAD--------NRLP-ENLKPKD--- 217 Escherichia coli
O25731 160 KVLPGEGGHVSFAPFDDLEILVWQYARSKF--NHVSAERFLSGSGLVLIYEALSKRKgle---kvAKLSkAELTPQI--- 231 Helicobacter pylori 2...
Q55855 169 RVFASEGAHGDFAPRSPLEWQLLEYLKKKYslGRISIERVVSGMGIAMIYEFLRHQYperesaqfSKLYqTWNREKDqet 248 Synechocystis sp. PCC...
1Q18_A 229 --------ITERALADSCTDCRRALSLFCVIXGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKE 300 Escherichia coli
P46880 218 --------ITERALADSCTDCRRALSLFCVIMGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKE 289 Escherichia coli
O25731 232 --------ISECALNGDYPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGRMGA 303 Helicobacter pylori 2...
Q55855 249 ktvdlaaaVSQAALEGTDVLADQAMELFLGAYGAEAGNLALKLLPRGGLYVAGGIAPKIIPLLEKGSFMQGFSDKGRMQS 328 Synechocystis sp. PCC...
1Q18_A 301 YVHDIPVYLIVHDNPGLLGSG 321 Escherichia coli
P46880 290 YVHDIPVYLIVHDNPGLLGSG 310 Escherichia coli
O25731 304 FLASIPVHVVLKKTPGLDGAG 324 Helicobacter pylori 26695
Q55855 329 LMGTIPVQVVLNAKVGLIGAA 349 Synechocystis sp. PCC 6803 substr. Kazusa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap