Conserved Protein Domain Family
yjbN

?
TIGR00742: yjbN 
tRNA dihydrouridine synthase A
This model represents one branch of COG0042 (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family). It represents a distinct subset by a set of shared unique motifs, a conserved pattern of insertions/deletions relative to other nifR3 homologs, and by subclustering based on cross-genome bidirectional best hits. Members are found in species as diverse as the proteobacteria, a spirochete, a cyanobacterium, and Deinococcus radiodurans. NifR3 itself, a protein of unknown function associated with nitrogen regulation in Rhodobacter capsulatus, is not a member of this branch. Members of this family show a distant relationship to alpha/beta (TIM) barrel enzymes such as dihydroorotate dehydrogenase and glycolate oxidase. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 129825
View PSSM: TIGR00742
Aligned: 4 rows
Threshold Bit Score: 531.321
Threshold Setting Gi: 488741562
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P72872        11 NPLSVAPMMDHTDRHFRYFLRQLTRHTLLYTEMITAQAILHGdRQRLLNFSPEEKPVALQLGGDDPQLLAECARIGQD-W 89  Synechocystis s...
P44794        11 GRFSVAPMLDWTTRHCRYFHRQFSKHALLYTEMVTAPAIIHA-KYDHLDFDLQENPVALQLGGSDPEQLKYCAKLAEE-R 88  Haemophilus inf...
WP_001307511  11 GRFSVAPMLDWTDRHCRYFLRLLSRNTLLYTEMVTTGAIIHG-KGDYLAYSEEEHPVALQLGGSDPAALAQCAKLAEA-R 88  Enterobacteriaceae
WP_002664922   3 RKISIAPMVNITDEHFRYLIRLLSKKVTLYTPMISAKSIIMGdVKKIVKQNPLESPIAIQIATNSKNDALKAIQILEKhF 82  Lyme disease sp...
P72872        90 GYDEINLNVGCPSDRVQSGNFGACLMAQPDLVAQCVSAMQKAVEIPVTVKHRIGIDHR------DSYEDLVHFVEIVANA 163 Synechocystis s...
P44794        89 GYHEINLNVGCPSDRVQNGMFGACLMAKADLVADCVEQMQSAVKIPVTVKTRIGIDEL------DSYEFLCDFIEKVQGK 162 Haemophilus inf...
WP_001307511  89 GYDEINLNVGCPSDRVQNGMFGACLMGNAQLVADCVKAMRDVVSIPVTVKTRIGIDDQ------DSYEFLCDFINTVSGK 162 Enterobacteriaceae
WP_002664922  83 NFDEYNLNVGCPSLKIQNANCGACLMGNANQVGEILKTMKENTNKPISIKHRLGIRPLssdyknESYSEVKNFVKIISDF 162 Lyme disease sp...
P72872       164 G-CQRFTVHARKAWLQGLSPKENRTIPPLRYEDVYQLKKDFPQLLIEINGGITQTEQIQQHLSHVDAVMVGRAAYENPYL 242 Synechocystis s...
P44794       163 G-CQEFIIHARKAWLSGLSPKENREIPPLDYIRVYQLKRDFPHLTIAINGGIKTIEEMKQHLQYVDGVMVGREAYQNPSL 241 Haemophilus inf...
WP_001307511 163 GeCEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKRDFPHLTMSINGGIKSLEEAKAHLQHMDGVMVGREAYQNPGI 242 Enterobacteriaceae
WP_002664922 163 G-IKNFIVHARIAILKGFSPKNNRNIPKLRHEFVYKLKKENKNLFIEINGGINNSEQIKKHLSFVDSVMIGRSAFENPYF 241 Lyme disease sp...
P72872       243 FATVDRDIYHKTNLVPSRAEIIERMLPYVEERLRHGDRLNQITRHLLSLFNGQPRAKFWRRTLSDSTLLASAGPELLQTA 322 Synechocystis s...
P44794       242 LGQIDQALFDPNAPIVTAHEAVESMLPYIEQQLSQGIHLNHIVRHILGAFQNCKGARQWRRYLSENAFKQGAGIEVVETA 321 Haemophilus inf...
WP_001307511 243 LAAVDREIFGSSDTDADPVAVVRAMYPYIERELSQGTYLGHITRHMLGLFQGIPGARQWRRYLSENAHKAGADINVLEHA 322 Enterobacteriaceae
WP_002664922 242 IANASREFLNETDEILTRKDILMQMVEYIKEYEN-YLSINILFKHLMGIVFSKEGAKKFRQNLTAPFPKNLKKHEILLKA 320 Lyme disease sp...
P72872       323 LQAQKF 328 Synechocystis sp. PCC 6803 substr. Kazusa
P44794       322 LSFVES 327 Haemophilus influenzae Rd KW20
WP_001307511 323 LKLVAD 328 Enterobacteriaceae
WP_002664922 321 IETLPE 326 Lyme disease spirochete
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap