Conserved Protein Domain Family
nifR3_yhdG

?
TIGR00737: nifR3_yhdG 
putative TIM-barrel protein, nifR3 family
This model represents one branch of COG0042 (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family). This branch includes NifR3 itself, from Rhodobacter capsulatus. It excludes a broadly distributed but more sparsely populated subfamily that contains sll0926 from Synechocystis PCC6803, HI0634 from Haemophilus influenzae, and BB0225 from Borrelia burgdorferi. It also excludes a shorter and more distant archaeal subfamily.The function of nifR3, a member of this family, is unknown, but it is found in an operon with nitrogen-sensing two component regulators in Rhodobacter capsulatus.Members of this family show a distant relationship to alpha/beta (TIM) barrel enzymes such as dihydroorotate dehydrogenase and glycolate oxidase. [Unknown function, General]
Statistics
?
PSSM-Id: 129820
View PSSM: TIGR00737
Aligned: 9 rows
Threshold Bit Score: 474.545
Threshold Setting Gi: 6647988
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O53835        15 IGPIELASPVVLAPMAGVTNVAFRALCRQLEqskvgtvSGLYVCEMVTARALIERH-PVTMHMTTFSADESPRSLQLYTV 93  Mycobacterium t...
P37567         4 IGDIQLKNRVVLAPMAGVCNSAFRLTVKEFG-------AGLVCAEMVSDKAILYNN-ARTMGMLYIDEREKPLSLQIFGG 75  Bacillus subtil...
Q55724        35 IGSLTLHSRVLQSPLSGVTDLVFRRLVRRYAp------QAMLYTEMVSATEIHHLR--TLPQVMEIDPRENPISIQLFDC 106 Synechocystis s...
Q9ZED2         4 IGNIELSSNVILAPMSDVTDLEFRKLVKRFG-------AGLVVSEMIASRAMIMKSrQSMQKCAIMHDDPTSACVQLAGC 76  Rickettsia prow...
P25717         3 IGQYQLRNRLIAAPMAGITDRPFRTLCYEMG-------AGLTVSEMMSSNPQVWES-DKSRLRMVHIDEPGIRTVQIAGS 74  Escherichia coli
P44965         3 IGSYQLRNRVLLAPMAGITDQPFRRLCAYYG-------AGLTFSEMMSTNPQVWHT-EKSKLRLAHSEDLGLNAVQIAGS 74  Haemophilus inf...
O83945        12 IGPLSLKGNVFFAPVAGYSDSAFRSIAIEWE-------ASFTYTEMVSSEAMVRDS-LNTKRLIRRASNETHYAIQIFGS 83  Treponema palli...
WP_010883405   7 IKNILLRSSIVYAPLAGFSDYPYRCMSALYQ-------PGLMFCEMVKVEGILYAP-ERTSKLLDYNENMRPIGAQLCGS 78  Chlamydia pneum...
WP_009872014   7 IKNLPLKSPVVYAPLAGFSDFPYRRMSAEYR-------PALMFCEMVKMEGLHYCP-QRTLRLLDFAESMRPIGGQLCGS 78  Chlamydia trach...
O53835        94 DPDTTYAAARmIAGEGLADHIDMNFGCPVPKVTKRGGGAALPFKRRLFGQIVAAAVRATEgt--dIPVTVKFRIGIDDAH 171 Mycobacterium t...
P37567        76 KKETLVEAAKfVDQNTTADIIDINMGCPVPKITKCDAGAKWLLDPDKIYEMVSAVVDAVN-----KPVTVKMRMGWDEDH 150 Bacillus subtil...
Q55724       107 RPDFMAEAAQ-KAVAQGAQSVDINMGCPVNKITKKGGGSSLLRQPAVAEAIVKTVVAAVD-----VPVTVKTRLGWDDGE 180 Synechocystis s...
Q9ZED2        77 EPDVIAEAAK-MNEDMGAKIIDLNFGCPAKKVVGGYAGSALMRDEQLAAKIFEATVKAVK-----IPVTVKMRIGWDDNT 150 Rickettsia prow...
P25717        75 DPKEMADAAR-INVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDVVKSILTEVVNAVD-----VPVTLKIRTGWAPEH 148 Escherichia coli
P44965        75 DPLEMAQAAA-INVEYGAQIIDINMGCPAKKVNRKLAGSALLQFPDLVEKILREVVSAVN-----VPVTLKIRTGWDKSN 148 Haemophilus inf...
O83945        84 NPAVMAETAKlIVDSAQPSCIDINAGCPMPKITKTGAGAALTREPTRLYEVVKAVADAVYaqdarIPVTVKIRAGWEEAH 163 Treponema palli...
WP_010883405  79 NPETSGEAAK-ILEGLGFDLIDLNCGCPTDKITKDGSGSGLLKTPELIGRILDKIINSVS-----IPVTVKIRSGWDMEH 152 Chlamydia pneum...
WP_009872014  79 RPDLAGESAK-ILEGLGFDLIDLNCGCPTDRITKDGSGSGMLKTSELIGKVVEKMVEVVS-----VPVTVKIRSGWDFDH 152 Chlamydia trach...
O53835       172 HTHLDAGRIAEAEGAAAVALHARTAAQRYSGTADWEQIARLKQHVRt---IPVLGNGDIYDAGDALAMMSTTGCDGVVIG 248 Mycobacterium t...
P37567       151 IFAVKNAQAVERAGGKAVALHGRTRVQMYEGTANWDIIKEVKQSVS----IPVIGNGDVKTPQDAKRMLDETGVDGVMIG 226 Bacillus subtil...
Q55724       181 INIVEFAQRLQDAGAQMLTLHGRTRAQGYNGRARWQWIAKVKQALT----IPVIANGDIFSVEAAIACLEETGADGVMCS 256 Synechocystis s...
Q9ZED2       151 RNAPTLAKIAANSGVQMVTVHGRTRCQFYSGNANWDFIRTVKEAVK----IPVIANGDITNFAKAKEALQRSGADGIMVG 226 Rickettsia prow...
P25717       149 RNCEEIAQLAEDCGIQALTIHGRTRACLFNGEAEYDSIRAVKQKVS----IPVIANGDITDPLKARAVLDYTGADALMIG 224 Escherichia coli
P44965       149 RNCVQIGKIAEQCGIQALTVHGRTRACLFEGEAEYDNIKAVKQAIA----IPVIANGDIDSARKAKFVLNYTGADAIMIG 224 Haemophilus inf...
O83945       164 LTWKEAARAAVDAGAQALALHPRTCAQCYAGEANWDIIADLVQCARgwgeVPVFGSGDLHAPEDARAMLEHTACAGVMFA 243 Treponema palli...
WP_010883405 153 INVEDTVRIIRDAGASAVFVHGRTRAQGYHGPSKQEYISRAKAAAGk--eFPVFGNGDIFSPEAAQAML-TTGCDGVLVA 229 Chlamydia pneum...
WP_009872014 153 INVEETVRIIKESGASAVFVHGRTRSQGYQGPSNLEFISRAKQAAGn--dFPVFGNGDVFSPEAAKTMLETTHCDGVLVA 230 Chlamydia trach...
O53835       249 RGCLGRPWLFAELSAAFTGSPAPTPPTLGEVADIIRRHGTLLAAHFG-EDKGMRDIRKHIAWYLHGFPAGSALRRALAMV 327 Mycobacterium t...
P37567       227 RAALGNPWMIYRTVQYLETGKLKEEPQVREKMAVCKLHLDRLIDLKG-ENVAVREMRKHAAWYLKGVKGNANVRNEINHC 305 Bacillus subtil...
Q55724       257 RGSLGYPFLVGEIEHFFKTGEKRKAPTVAEKLTCAQEHLQMLWEYKG--QRGLFQARKHLAWYCKDFPGAAALREQLFQI 334 Synechocystis s...
Q9ZED2       227 RGVYGKPWLISQIAYYLKTGKEKPAPSIAEQLDIITKHYDAIIDYYG-KSVGVPIARKHIIWYSNGLPSSAEFRCTVNLM 305 Rickettsia prow...
P25717       225 RAAQGRPWIFREIQHYLDTGELLPPLPLAEVKRLLCAHVRELHDFYG-PAKGYRIARKHVSWYLQEHAPNDQFRRTFNAI 303 Escherichia coli
P44965       225 RAALGNPWLFQAVENLIEHNSISQMPSLKEKCGQILRHIQELHQFYG-EQKGYRIARKHVAWYLQGIQPDSVFKQTFNAI 303 Haemophilus inf...
O83945       244 RGAMGNPFIFRQTRQLLTEGYYT-PVTFEQKLRAAWRELHLLAQDVG-ESSACKQMRKRFVSYAKGERGKTQWCQRAVHA 321 Treponema palli...
WP_010883405 230 RGTLGAPWIGKQIQDYLTTGSYEK-IPFIKRKAAFLEHMRLVEDYYQsETKFLSETRKLCGHYLISAAKVRFLRSSLAKA 308 Chlamydia pneum...
WP_009872014 231 RGTMGAPWIGKQIEDYLTTGTYS-SPSFSTRKQAFVQHLQWIEEYYQsEEKLLTDTRKLCGHYLILSPKVRSLRANLAKA 309 Chlamydia trach...
O53835       328 KTFDELDCLLDRLDGTVP 345 Mycobacterium tuberculosis
P37567       306 ETREEFVQLLDAFTVEVE 323 Bacillus subtilis subsp. subtilis str. 168
Q55724       335 NSVQEGKDLLDQAISTAK 352 Synechocystis sp. PCC 6803 substr. Kazusa
Q9ZED2       306 KDPIAVKEKIAEFYMSVM 323 Rickettsia prowazekii str. Madrid E
P25717       304 EDASEQLEALEAYFENFA 321 Escherichia coli
P44965       304 SDPKEQLIVLEDFFNLIL 321 Haemophilus influenzae Rd KW20
O83945       322 SSFADFAAVIRDACPCIG 339 Treponema pallidum subsp. pallidum str. Nichols
WP_010883405 309 TSYQEVYQLVNDYEEADD 326 Chlamydia pneumoniae
WP_009872014 310 SSSQEVYQLIDGFeepte 327 Chlamydia trachomatis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap