Conserved Protein Domain Family
nifR3_rel_arch

?
TIGR00736: nifR3_rel_arch 
TIM-barrel protein, putative
Members of this family show a distant relationship by PSI-BLAST to alpha/beta (TIM) barrel enzymes such as dihydroorotate dehydrogenase and glycolate oxidase. At least two closely related but well-separable families among the bacteria, the nifR3/yhdG family and the yjbN family, share a more distant relationship to this family of shorter, exclusively archaeal proteins. [Unknown function, General]
Statistics
?
PSSM-Id: 129819
View PSSM: TIGR00736
Aligned: 3 rows
Threshold Bit Score: 321.848
Threshold Setting Gi: 499180709
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q57608        20 MAGITDGDFCRKFKD-LFAIVTIGGYNLDSATYKASRDIEKRGRKEFSINLEEFNSYIIEQIKKArESNALVSVNVRFVD 98  Methanocaldococ...
WP_010876647   1 MAGISDAEFCLKLIPyGFDMVTLGGYNADRETSRAGRLIAQRGRPEFDFDCSELRSIINHEASRI-KERFDVMVSVNIRA 79  Methanothermoba...
WP_010878249  12 MAGVNNAEFCRKQK---ASLVILGGFNADRRALEAAEKAVKRGRKEFLFGIDGIEGEIKKLG------RRKFAVNVRSSS 82  Archaeoglobus f...
Q57608        99 IDEAYDKLLTIAKHADIIELNCHCRQPEITSLGIGQELMKNKNLLKEFLTKMK-ELNKPIFLKIRLNCIPLKELIDNLNY 177 Methanocaldococ...
WP_010876647  80 LEPERIVEISSIESVDVVEINAHCRQPEITEIGAGQSMLMDPEFLEDFTAEVTgKARSEVSVKIRGNVPGADTVGVAGVL 159 Methanothermoba...
WP_010878249  83 LEGYLNVAELVAEFEGIIEINAHCRQPEFVEIGCGEWLLFNHERLVEIVSKTS--RIAPTFVKIRG-GHKLDYEKIARKL 159 Archaeoglobus f...
Q57608       178 VRDYFDGLHVDCFYPGKPYADMDSLKILAEEFNDKIIIGNNSIDSIEKAKEMLKY-SDFVSVARTILKGNVEWI 250 Methanocaldococcus ja...
WP_010876647 160 ADLGVDYIHLDAMKPGEDRADLELVSLVSEVKGDSILIGNNSVRDIESARAMLAAgADAVSVARAAISGRLGFN 233 Methanothermobacter t...
WP_010878249 160 FDAGCLAIHVDAMIPGGG-CDFSLIERISRIGN---VIGNNSFVDIESGERIIMAgAKMASAARAVLRDENFFE 229 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap