1T35


Conserved Protein Domain Family
TIGR00730

?
TIGR00730: TIGR00730 
Click on image for an interactive view with Cn3D
TIGR00730 family protein
This model represents one branch of a subfamily of proteins of unknown function. Both PSI-BLAST and weak hits by this model show a low level of similarity to and suggest an evolutionary relationship of the subfamily to the DprA/Smf family of DNA-processing proteins involved in chromosomal transformation with foreign DNA. Both Aquifex aeolicus and Mycobacterium leprae have one member in each of two branches of this subfamily, suggesting that the branches may have distinct functions. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129813
View PSSM: TIGR00730
Aligned: 5 rows
Threshold Bit Score: 270.539
Threshold Setting Gi: 6458157
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1T35_A         2 KTICVFAGSNPGGNEAYKRKAAELGVYXAEQGIGLVYGGSrVGLXGTIADAIXENGGT---------------------- 59  Bacillus subtilis
AAF10050      54 PLVTVYGSARTALTDRYYGLAQTLGRELVGAGFGVVTGGG-PGIMQAANQGAYEAGGV---------------------- 110 Deinococcus rad...
WP_014906568  14 KTICVFAGSNPGGNEAYKRKAAELGVYMAEQGIGLVYGGSrVGLMGTIADAIMENGGT---------------------- 71  Bacillus subtilis
WP_003898770  11 WTVAVYCAASP-THAELLELAAEVGAAIAGRGWTLVWGGGhVSAMGAVASAARACGGW---------------------- 67  Mycobacterium t...
P47044        19 KSVCVYCGSSFGAKALYSESAEELGALFHKLGWKLVYGGGtTGLMGKIARSTMGPDLSgqvhgiipnalvskertdedke 98  Saccharomyces c...
1T35_A        60 ----AIGVXpSGLFSGEVVHQNLTELIEVNGXHERKAKXSELADGFISXPGGFGTYEELFEVLCWAQIGIHQKPIGLYNV 135 Bacillus subtilis
AAF10050     111 ----SVGLN-IVLPHEQRHNPYQTLSLEFEYFHARKVMLARYAHAFVAFPGGFGTLDEMMEILTLVQTRKMRPVPIYFVG 185 Deinococcus rad...
WP_014906568  72 ----AIGVMpSGLFSGEVVHQNLTELIEVNGMHERKAKMSELADGFISMPGGFGTYEELFEVLCWAQIGIHQKPIGLYNV 147 Bacillus subtilis
WP_003898770  68 ----TVGVIpKMLVYRELADHDADELIVTDTMWERKQIMEDRSDAFIVLPGGVGTLDELFDAWTDGYLGTHDKPIVMVDP 143 Mycobacterium t...
P47044        99 dvnkALLESvENHKGATPISEEYGETTIVPDMHTRKRMMANLSDAFVAMPGGYGTFEEIMECITWSQLGIHNKPIILFNI 178 Saccharomyces c...
1T35_A       136 NGYFEPXXKXVK-YSIQEGFSNESHLKLIHSSSRPDELIEQXQNY 179 Bacillus subtilis
AAF10050     186 EAHWRGLVEWFRtSLVENGAIAADDLKLFKLVDDVSQIPADVRAY 230 Deinococcus radiodurans R1
WP_014906568 148 NGYFEPMMKMVK-YSIQEGFSNESHLKLIHSSSRPDELIEQMQNY 191 Bacillus subtilis
WP_003898770 144 WGHFDGLRAWLN-GLLDTGYVSPTAMERLVVVDNVKDALRACAPS 187 Mycobacterium tuberculosis complex
P47044       179 DGFYDKLLEFLK-HSIQERFISVKNGEIIQVASTPQEVVDKIEKY 222 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap