Conserved Protein Domain Family
ISP4_OPT

?
TIGR00727: ISP4_OPT 
small oligopeptide transporter, OPT family
This model represents a family of transporters of small oligopeptides, demonstrated experimentally in three different species of yeast. A set of related proteins from the plant Arabidopsis thaliana forms an outgroup to the yeast set by neighbor joining analysis but is remarkably well conserved and is predicted here to have equivalent function. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 129810
View PSSM: TIGR00727
Aligned: 3 rows
Threshold Bit Score: 1032.13
Threshold Setting Gi: 786296
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAA03147  67 EEDSPYPEVRAAVPPTDDPSMPCNTIRMWTIGLIYSTVGAAVNMFFSLRNPTVTLSVLISELLAYPALQIWDLIFPDreF 146 fission yeast
AAB69628  67 EDDSPYPEVRAAVPSTDDPTLPQNTIRAWVIGLILTTVGCGMNMLFSFHSPSFAITTFVTSILAWPIGNFWAWIVPD--W 144 Candida albicans
AAB64623 141 KFHSPYQEVRAVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPIIQMFLYICGKAWAKTIPCwtI 220 baker's yeast
BAA03147 147 RIGRLKFNf-kPGPFNVKEHALIVVMSSVSFGN--AYSTDIILAQRVHYKQRFGFGYEICLTLATQLIGYGLAGLSRRLL 223 fission yeast
AAB69628 145 KIFGASLN---PGPFNVKEHTIITIMANVSFGTgaAYATDILLAQNMFYKSNFGWGYNLLLIWSTQCIGFAFGGVMRRFV 221 Candida albicans
AAB64623 221 TIRGRKYGiniDKPWTQKEQMFSTLLYAICQGA--FYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFV 298 baker's yeast
BAA03147 224 VRPASMLWPVNLVQCTLIKTLHRKdlRNAVANGWRISPFRFFLYVFIASFIWNWFPSYIFQALSLFAWVTWIRPNSPTVN 303 fission yeast
AAB69628 222 VDSPGAIWPSNLVTATFLTNMHIN--ENHTANGWKISRLAFFVIVFVASFVWYWFPGYIFQALSYFSWITWIKPNNVIIN 299 Candida albicans
AAB64623 299 VYPARALWPTVMPTIAINKALLGK--EKHESG---MSRYKFFFLTFFIMFIYNWFPTYIINILNTFNWMTWIKPSNINLA 373 baker's yeast
BAA03147 304 QIFGESTGISILP--MTFDWNQISAYILSPLMAPADALMNILLGVILFFWIVTPALNFTNTWYGDYLPISSSGIIDHFGN 381 fission yeast
AAB69628 300 QVFGSSSGLGMIPnnIALDWNQIAGYIGSPLIPPASVIATIFGSIVLIFWIVVPAIHYSNTWYSQYLPISSTGSFDRFQQ 379 Candida albicans
AAB64623 374 NITGGVTGLGINPi-SSFDWNVIS--FNSPLVYPFWSYLTQYLGCILAALIVI-AVYYSNYMSCQYLPIFTNSLYTNTGH 449 baker's yeast
BAA03147 382 SYNVTRILT-KDATFDLDAYQNYSPIFMSTTYALAFGLSFASITSVIFHVILYHGKEIYDRLRD---------------- 444 fission yeast
AAB69628 380 TYNVSKIIDhKTLSFNEAEYKKYSPLFLSTTFAISYGLSFASILATITHTICFHGRDLIASLKA---------------- 443 Candida albicans
AAB64623 450 SFKVTEVLD-SDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFIVHSKLLFNAFKDwalnlwamrklkswvt 528 baker's yeast
BAA03147 445 ---------PPAPDIHEKLMKAYDEVPFYWYLSVFLAFFGMMMGTIYGWKTETPWWVIIVGVIFSAVWFIPIGIVQAITN 515 fission yeast
AAB69628 444 ---------KEKPDVHNRLMKAYKPVPEWWYLVVFLVFFGMSIATVRAWPTEMPVWGLVFALIIAIIFLLPVAIIYAKTN 514 Candida albicans
AAB64623 529 mfksdyralDDYDDPHSNAMKNYKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPTTILQATTG 608 baker's yeast
BAA03147 516 IQLGLNVFTEFIVGYMYPGRPLAMMIFKTVGYITMTQGLAFAADLKFGHYMKLPPRIMFYTQMIATIWSCFVQIGVLDWA 595 fission yeast
AAB69628 515 IAVGLNVVTEFIVGYVLGGRPLCMMLFKTFGYITNNQAVTFVQDMKLGHYMKIDPRTLFWAQFAATIWGSLVQIAVLEWA 594 Candida albicans
AAB64623 609 YSFGLNLLIEMVMGYALPGNPIAIMILKAFGYNIDGQADNYVSNLKIAHYCKIPPMALFRGQCVIVFIQIFVNLGVLNWQ 688 baker's yeast
BAA03147 596 LGNIDNVCQADQPDNYTCPNATVFFNSSVIWGVIGPKRMFSGKNTYTGLQYFWLAGVLGTILFWALWKKWPQKWWGQLNG 675 fission yeast
AAB69628 595 YGAIDNLCAADQKNHYTCPNGKVFFNASIIWGVIGPQRQFSHGQIYYGLLFFFIIGAVTPVINWLILKKWPNSPVKYLHW 674 Candida albicans
AAB64623 689 ISNIKDFCTPHQNAKFTCPDAVTYYNASVVWGAIGPKRIFN--YIYPIFKWCWLIGACIGIFFG-VWKRWGKFYPRYFD- 764 baker's yeast
BAA03147 676 PLIFGGTGYIPPATPVNYLAWSG---IGLFFNYYLKKIFADWWQKYNFTLSA-LDTGTQLSVIILFFCLQLPMVNF 747 fission yeast
AAB69628 675 PVFFSGTGYIPPATPYNYTSYCA---VGLFFGWWIKKKWFHWWSKYNYSLSAgLDIGLAWCSLIIFLCLSLTNTDF 747 Candida albicans
AAB64623 765 PMLFVG-GMLNMSPPYNLMYYTSgmiVSYISQYYMKRHHLNLWEKYNYVLSAgFSTGLVLSAIIIFFAVQYKDTAF 839 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap