Conserved Protein Domain Family
urea_amlyse_rel

?
TIGR00724: urea_amlyse_rel 
biotin-dependent carboxylase uncharacterized domain
Urea amidolyase of Saccharomyces cerevisiae is a 1835 amino acid protein with an amidase domain, a biotin/lipoyl cofactor attachment domain, a carbamoyl-phosphate synthase L chain-like domain, and uncharacterized regions. It has both urea carboxylase and allophanate hydrolase activities. This model models a domain that represents uncharacterized prokaryotic proteins of about 300 amino acids, regions of prokaryotic urea carboxylase and of the urea carboxylase region of yeast urea amidolyase, and regions of other biotin-containing proteins. [Unknown function, General]
Statistics
?
PSSM-Id: 129807
View PSSM: TIGR00724
Aligned: 5 rows
Threshold Bit Score: 447.694
Threshold Setting Gi: 490011178
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAC41643     1079 AIEITLPGAHTSIQDYpGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPSIVFHCeTVIAITGG--TA 1156 baker's yeast
P75745          1 MLKIIRAGMYTTVQDG-GRHGFRQSGISHCGALDMPALRIANLLVGNDANAPALEITLGQLTVEFET-DGWFALTGagCE 78   Escherichia c...
P44298          1 MIDILDVKSRATIQDL-GRFGLRRFGISHCGAMDKLALRAGNILLGNAENVPAIEVPLGGITLQFQQ-DMNFCVTGafYE 78   Haemophilus i...
WP_010885078    3 MIEIISAPSPLLIQDL-GRRGYLKYGVPKSGVMDEVSARLANYLVGNPDDSPLLEFTLVGPTIRFNS-SAVFAVAGd-VD 79   Pyrococcus ho...
WP_003913910    8 TLEILRSGPLALVEDL-GRAGLAHLGVGRSGAADRRSHTLANRLVANPDDWATVEVTFGGFSARVRGgDVDIAVTGadTD 86   Mycobacterium...
AAC41643     1157 LCTLDGQEIPQHKpVEVKRGSTLSIGKLTSGCRAYLGIRGGIDVPKYLGSYSTFTLGNVGGYNGRVLKLGDVLFLPSNEe 1236 baker's yeast
P75745         79 ARLDDNAVWTGWR-LPMKAGQRLTLKRPQHGMRSYLAVAGGIDVPPVMGSCSTDLKVGIGGLEGRLLKDGDRLPIGKSK- 156  Escherichia c...
P44298         79 MMLDDKPVFAYWR-YQVRAGQILKMARAKIGMYGYLCVQGGFVLPQALNSCSTDLRAQIGGIEGRCLQAGDQLQTAN-D- 155  Haemophilus i...
WP_010885078   80 VYLNDVKIEP-WRsYWAKRGDILRVGMLKSGMYGYIAFAGGIECDRILGSCSTYLRANFG----KPLKPGDKLKLGY--- 151  Pyrococcus ho...
WP_003913910   87 PTVNGIMVGT-NSiHHVRDGQVISLGTPRAGLRTYLAVRGGVCVEPVLGSRSYDVMSAIGP---SPLRAGDVLPVGEHT- 161  Mycobacterium...
AAC41643     1237 nksvecLPQNIPQSLIPqiseTKeWRIGVTCGPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSngge 1316 baker's yeast
P75745        157 ------RDSMEAQGVKQ----LL-WGNRIRALPGPEYHEFDRASQDAFWRSPWQLSSQSNRMGYRLQGQILKRTTD---- 221  Escherichia c...
P44298        156 ------HILRSEIGIAP----IP-LRDVIRALPSSEYQAFKRKSQYYWWRNEWTLQSNSDRMGYRFQGQTLELKQP---- 220  Haemophilus i...
WP_010885078  152 ------AILTEKVGKSLpeefIPkYGKEIRVILGPNLENFTRNGIETFLISEYVVTKESDRMGYRLDGPRIEHSDKg--- 222  Pyrococcus ho...
WP_003913910  162 ------DDYPELDQAPVa--aIEeHLVELRVVPGPRDDWLVDP--DALVHTIWMASNRSDRVGMRLQGRPLQHRWPd--- 228  Mycobacterium...
AAC41643     1317 ggmHPSNTHDYVYSLGAINFTGdEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPLSYESSRSLKESQEV 1396 baker's yeast
P75745        222 ---RELLSHGLLPGVVQVPHNG-QPIVLMNDAQTTGGYPRIACIIEADMYHLAQIPLGQPIHFVQCSLEEALKARQDQQR 297  Escherichia c...
P44298        221 ---LEMLSHAIQFGSVQVPPSG-QPIILMADAQTTGGYPKIANVIDADLGALAQVRLGSTIKFEAVSLQEAAKLRRKNEI 296  Haemophilus i...
WP_010885078  223 ---ADIITEAIPLGSIQVPANG-KPIVMLADAQTTGGYAKIAVVSKVDLPAIAQKRPGEKVKFREISVKEAQELLKARER 298  Pyrococcus ho...
WP_003913910  229 ---RQLPGEGVTRGAIQVPPNG-LPVILGPDHPITGSYPVVGVITDEDIDKVAQIRPGQYVRLHWARPRSRLPGQGVTQA 304  Mycobacterium...
AAC41643     1397 AIKSLDGTKLRRlD 1410 baker's yeast
P75745        298 YFEQLAWRLHNE-N 310  Escherichia coli K-12
P44298        297 YLDQIRRIVDEK-N 309  Haemophilus influenzae Rd KW20
WP_010885078  299 TMKALRKALTAEgn 312  Pyrococcus horikoshii
WP_003913910  305 W------------- 305  Mycobacterium tuberculosis complex
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap