2ISB


Conserved Protein Domain Family
ttdB_fumA_fumB

?
TIGR00723: ttdB_fumA_fumB 
Click on image for an interactive view with Cn3D
hydro-lyases, Fe-S type, tartrate/fumarate subfamily, beta region
A number of Fe-S cluster-containing hydro-lyases share a conserved motif, including argininosuccinate lyase, adenylosuccinate lyase, aspartase, class I fumarate hydratase (fumarase), and tartrate dehydratase (see PROSITE:PDOC00147). This model represents a subset of closely related proteins or modules, including the E. coli tartrate dehydratase beta chain and the C-terminal region of the class I fumarase (where the N-terminal region is homologous to the tartrate dehydratase alpha chain). The activity of archaeal proteins in this subfamily has not been established.
Statistics
?
PSSM-Id: 129806
View PSSM: TIGR00723
Aligned: 7 rows
Threshold Bit Score: 235.795
Threshold Setting Gi: 119390285
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2ISB_A        26 DQILKLKVGDVVYITGEIFTARDEAHARALEWxeeGKELPFSFDKGVVYHCGPLVKKNDE------------WRVVSAGP 93  Archaeoglobus f...
P05851        12 EDLQDIRVGDVIYLTGTLVTCRDVCHRRLIEL---KRPIPYDLNGKAIFHAGPIVRKNGDk-----------WEMVSVGP 77  Escherichia coli
AIG97974      12 DQILKLKVGDVVYITGEIFTARDEAHARALEWmeeGKELPFSFDKGVVYHCGPLVKKNDE------------WRVVSAGP 79  Archaeoglobus f...
WP_001691304  59 AQLSQYPVSTRLSLTGTIIVGRDIAHAKLKELidaGKELPQYIKDHPIYYAGPAKTPAGYp-------------SGSLGP 125 Escherichia coli
WP_010877506  14 EEVTELRVGDVVYINGRIFTARDRAHKRILE-----RGAPFDIEGSVIFHAGPIIRFNEEpnttaesirdpqAELVVVGP 88  Methanothermoba...
WP_004081363   1 MRIEDLKAGQEIRYSGKLIVMRDQAQRRLKEIvdrGEEPPVDLRGQIVFYAGPAKTPSGKp-------------VGAIGP 67  Thermotoga
Q58034        11 KDVKKLKVGDIVYLNGKIYTARDEAHLKIIEMlksNEKLPFDLNESIIYHAGPIMKKVNDs-----------WVCVSIGP 79  Methanocaldococ...
2ISB_A        94 TTSARXNPFTPKILEKVECXGIIGKGGXSEEVVEAXRG-KAAYFAFTGGAGALAAXS-IKKVKGVVWED-LGXPEAVWLL 170 Archaeoglobus f...
P05851        78 TTSMRMESFEREFIEQTGVKLVVGKGGMGPLTEEGCQKfKALHVIFPAGCAVLAATQ-VEEIEEVHWTE-LGMPESLWVC 155 Escherichia coli
AIG97974      80 TTSARMNPFTPKILEKVECMGIIGKGGMSEEVVEAMRG-KAAYFAFTGGAGALAAMS-IKKVKGVVWED-LGMPEAVWLL 156 Archaeoglobus f...
WP_001691304 126 TTAGRMDSYVDLLQSHGGSMIMLAKGNRSQQVTDACHKhGGFYLGSIGGPAAVLAQQsIKHLECVAYPE-LGM-EAIWKI 203 Escherichia coli
WP_010877506  89 TTSGRMNPFQPEVLG-LGVRAVIGKGGMDDRTGSALRRyGAVYLAAVGGCAALYGSA-VKGIRAVHWLD-LGVPEAIWEL 165 Methanothermoba...
WP_004081363  68 TTSARMDDYLEMLFK-LGAIATIGKGKRSKKAIEACKKwKRVYFVTPSGTAAALSKR-VKKSRVLAFED-LG-PEAIYEI 143 Thermotoga
Q58034        80 TTSARMNDVEEEFIKLTNISAIVGKGGMKKELLKTFEDyGVVYLAAPGGCAALLANS-VKRVDNVYFLDeLGMPEAVWEL 158 Methanocaldococ...
2ISB_A       171 EVERFGPCIVAIDAHGN-SLYRR 192 Archaeoglobus fulgidus
P05851       156 RVKEFGPLIVSIDTHGN-NLIAE 177 Escherichia coli
AIG97974     157 EVERFGPCIVAIDAHGN-SLYRR 178 Archaeoglobus fulgidus DSM 8774
WP_001691304 204 EVEDF-PAFILVDDKGN-DFFQQ 224 Escherichia coli
WP_010877506 166 EVEEFGPLIVAMDSTGRsSIIQR 188 Methanothermobacter thermautotrophicus
WP_004081363 144 EVEDF-PLIVAIDSNGN-TIFKE 164 Thermotoga
Q58034       159 EVNNFGPLIVAMDSHGN-SIYEE 180 Methanocaldococcus jannaschii DSM 2661
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap