Conserved Protein Domain Family
tfx

?
TIGR00721: tfx 
DNA-binding protein, Tfx family
PSI-BLAST starting with one member of this family converges with significant hits only to other members of the family, which is restricted to the Archaea. Homology is strongest in the helix-turn-helix-containing N-terminal region. Tfx from Methanobacterium thermoautotrophicum is associated with the operon for molybdenum formyl-methanofuran dehydrogenase and binds a DNA sequence near its promoter. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 129804
View PSSM: TIGR00721
Aligned: 3 rows
Threshold Bit Score: 187.392
Threshold Setting Gi: 499187314
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA08778       1 MSKKTFLTERQKTVLEMRERGWSQKKIARELKTTRQNVSAIERKAMENIEKSRNTLDFVKFLKSPVRILCRRGDTLDEII 80  Methanothermoba...
WP_010869668  21 MVEDSFLTDTQIKVLKLRKKGLTQEEIAKMLGTSRANISMIEKRAKENIKKAYNTIKIYNRIMAPLSIEIEEGTDVLEIP 100 Methanocaldococ...
WP_010884854  23 LPMKTFLTEQQIKVLVLRAKGLKQSEIAKILKTTRANVSILEKRALEKIEKAKNTLLLWEQINSKVNVNVKAGEDIFSVP 102 Pyrococcus hori...
CAA08778      81 KRLLEESNKEGIHVIHDSITLAFLIREKASHRIVHRVVKSDFEIGV-----TRDGEIIVDLN 137 Methanothermobacter thermautotrop...
WP_010869668 101 DIVFKKADEEGIKVKYNTLELIELIKENASEFIEKRTVKKKFKIYI-----LENGDLDVGGS 157 Methanocaldococcus jannaschii
WP_010884854 103 EKLFKKADEAGVKVPYSTAEIIAFLVEHAP--IENRLAKRDFVIFLdsknrLRISDCLINLD 162 Pyrococcus horikoshii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap