Conserved Protein Domain Family

TIGR00719: sda_beta 
L-serine dehydratase, iron-sulfur-dependent, beta subunit
This enzyme is also called serine deaminase. This model describes the beta chain of an iron-sulfur-dependent L-serine dehydratase, as in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of beta chains from the homologous region of single chain forms such as found in E. coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis]
PSSM-Id: 129802
Aligned: 2 rows
Threshold Bit Score: 338.826
Threshold Setting Gi: 6094257
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
O34635 159 TIAGVANVLAKFSINVGHMEVARKDIGQLALMTIEVDQNIDDHILDEL 206 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap