Conserved Protein Domain Family
sda_alpha

?
TIGR00718: sda_alpha 
L-serine dehydratase, iron-sulfur-dependent, alpha subunit
This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis]
Statistics
?
PSSM-Id: 129801
View PSSM: TIGR00718
Aligned: 2 rows
Threshold Bit Score: 463.703
Threshold Setting Gi: 6094255
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O34607   1 MFRNVKELIEITKEKQILISDVMIAQEMEVTEKTKEDIFQQMDHNLSVMEAAVQKGL-EGVTSQTGLTGGDAVKLQAYIR 79  Bacillus subtilis sub...
P33073   1 MLNTAREIIDVCNERGIKIYDLVLEEEIKNSHTTEEEIRKKLDAVIDVMHASATKNLtQSDVTEYKMIDGFAKRTYEYAN 80  Peptoniphilus asaccha...
O34607  80 SGKSLSGPLILDAVSKAVATNEVNAAMGTICATPTAGSAGVVPGTLFAVKEKLNPTREQMIRFLFTAGAFGFVVANNASI 159 Bacillus subtilis sub...
P33073  81 SGKSIVGDFLAKAMAMAFSTSEVNASMGKIVAAPTAGSSGIMPAMLVAATEKYNFDRTTIQNGFLTSIGIGQVITKYATF 160 Peptoniphilus asaccha...
O34607 160 SGAAGGCQAEVGSASGMAAAAIVEMAGGTPEQSAEAMAITLKNMLGLVCDPVAGLVEVPCVKRNAMGASNAMIAADMALA 239 Bacillus subtilis sub...
P33073 161 AGAEGGCQAECGSASAMAAAALVEMLGGTVEQALHAASITIINVLGLVCDPIAGLVQYPCTFRNASGVINAFISADLALA 240 Peptoniphilus asaccha...
O34607 240 GITSRIPCDEVIDAMYKIGQTMPTALRETGQGGLAATPTGRELEKKIFGgaLGS 293 Bacillus subtilis subsp. subtilis str. 168
P33073 241 GVESLVPFDEVVIAMGEVGNSMIEALRETGLGGLAGSKTGQKIRRDFLK--EGD 292 Peptoniphilus asaccharolyticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap