1PW4


Conserved Protein Domain Family
glpT

?
TIGR00712: glpT 
Click on image for an interactive view with Cn3D
glycerol-3-phosphate transporter
This model describes a very hydrophobic protein, predicted to span the membrane at least 8 times. The two members confirmed experimentally as glycerol-3-phosphate transporters, from E. coli and B. subtilis, share more than 50 % amino acid identity. Proteins of the hexose phosphate and phosphoglycerate transport systems are also quite similar. [Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 129795
View PSSM: TIGR00712
Aligned: 4 rows
Threshold Bit Score: 745.512
Threshold Setting Gi: 3913741
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1PW4_A   2 SIFKPAPHKARLPAAEIDPTYRRLRWQIFLGIFFGYAAYYLVRKNFALAMPYLVEQG-FSRGDLGFALSGISIAYGFSKF 80  Escherichia coli
P08194   3 SIFKPAPHKARLPAAEIDPTYRRLRWQIFLGIFFGYAAYYLVRKNFALAMPYLVEQG-FSRGDLGFALSGISIAYGFSKF 81  Escherichia coli K-12
P37948   3 NIFKPAPHIERLDDSKMDAAYKRLRLQVFIGIFIGYAGYYLLRKNFAFAIPYLQEQG-FSKTELGLVLAAVSIAYGFSKF 81  Bacillus subtilis sub...
P96335   3 GPFKPAPHIAELPAEKIDSTYKRLRWQVFAGIFFGYAAYYFVRANFDLAQPGLIQAGlYSKAELGVIGSAAGLAYGLSKF 82  Haemophilus influenza...
1PW4_A  81 IMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVW 160 Escherichia coli
P08194  82 IMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVW 161 Escherichia coli K-12
P37948  82 IMGMVSDRCNPRYFLATGLFLSAIVNILFVSMPWVTSSVTIMFIFMFINGWFQGMGWPPCGRTMAHWFSISERGTKMSIW 161 Bacillus subtilis sub...
P96335  83 VMAGMSDRSNPRVFLPFGLLLSGLCMTLMGLFPWATSGIAIMWVMIFLNGWFQGMGWPPCGRTMVHWWSKSERGTIVSIW 162 Haemophilus influenza...
1PW4_A 161 NCAHNVGGGIPPLLFLLGMAWFN-----------DWHAALYMPAFCAILVALFAFAMMRDTPQSCGLPPIEEYKNDYPDD 229 Escherichia coli
P08194 162 NCAHNVGGGIPPLLFLLGMAWFN-----------DWHAALYMPAFCAILVALFAFAMMRDTPQSCGLPPIEEYKNDYPDD 230 Escherichia coli K-12
P37948 162 NVAHNIGGGILAPLVTLGIAMFV-----------TWKSVFFFPAIIAIIISFLIVLLVRDTPQSCGLPPIEEYRNDYPKH 230 Bacillus subtilis sub...
P96335 163 NTAHNIGGMVPGAMVLLASAIFFsthgieaqakdVWQQSLYFPGIAAMIFAIPVYFVMRDTPQSCGLPSIEKWRNDYPDD 242 Haemophilus influenza...
1PW4_A 230 YNEK-AEQELTAKQIFMQYVLPNKLLWYIAIANVFVYLLRYGILDWSPTYLKEVKHFALDKSSWAYFLYEYAGIPGTLLC 308 Escherichia coli
P08194 231 YNEK-AEQELTAKQIFMQYVLPNKLLWYIAIANVFVYLLRYGILDWSPTYLKEVKHFALDKSSWAYFLYEYAGIPGTLLC 309 Escherichia coli K-12
P37948 231 AFKN-QEKELTTKEILFQYVLNNKFLWYIAFANVFVYFVRYGVVDWAPTYLTEAKGFSPEDSRWSYFLYEYAGIPGTILC 309 Bacillus subtilis sub...
P96335 243 YNEKtYENDLTAKEIFVTYVLKNKLLWYIAIANVFVYLIRYGVLKWSPVYLSEVKHFNIKGTAWAYTIYELAAVPGTLLC 322 Haemophilus influenza...
1PW4_A 309 GWMSDKVFRGNRGATGVFFMTLVTIATIVYWMNPAG-------------NP--TVDMICMIVIGFLIYGPVMLIGLHALE 373 Escherichia coli
P08194 310 GWMSDKVFRGNRGATGVFFMTLVTIATIVYWMNPAG-------------NP--TVDMICMIVIGFLIYGPVMLIGLHALE 374 Escherichia coli K-12
P37948 310 GWISDRFFKSRRAPAGVLFMAGVFIAVLVYWLNPAG-------------NP--LVDNIALISIGFLIYGPVMLIGLQAID 374 Bacillus subtilis sub...
P96335 323 GWVSDKVFKGKRGLTGFIFMILTTAAVVAYWMNPATpeaelanysawyeNPyqLTDFVLMTLIGFLIYGPVMLIGLHALE 402 Haemophilus influenza...
1PW4_A 374 LAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFFGWDGGFMVMIGGSILAVILLIVVMIGEKR 439 Escherichia coli
P08194 375 LAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFFGWDGGFMVMIGGSILAVILLIVVMIGEKR 440 Escherichia coli K-12
P37948 375 LAPKKAAGTAAGLTGFFGYIGGSAFANAIMGFVVDRFNWNGGFIMLISSCILAIVFLALTWNTGKR 440 Bacillus subtilis subsp. subtilis s...
P96335 403 LAPKKAAGTAAGFTGLFGYLGGTVSASAVIGWAAQHYGWDGGFYVMIGGGVLAVLLLLIVMVEEGK 468 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap