Conserved Protein Domain Family
efflux_EmrB

?
TIGR00711: efflux_EmrB 
drug resistance transporter, EmrB/QacA subfamily
This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 129794
View PSSM: TIGR00711
Aligned: 6 rows
Threshold Bit Score: 560.074
Threshold Setting Gi: 685971521
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P27304        13 VIMTIALSLATFMQVLDSTIANVAIPTIAGNLGSSLSQGTWVITSFGVANAISIPLTGWLAKRVGEVKLFLWSTIAFAIA 92  Escherichia coli
P44927        17 ILLTLALSLATFMQVLDSTIANVAIPTIAGDLGASFSQGTWVITSFGVANAISIPITGWLAKRFGEVRLFLVSTFLFVVS 96  Haemophilus inf...
P54585        13 MSLLIVLMAGLFLAILNQTLLNVAMPHLMTEFGVSATTIQWLTTGYMLVNGVLIPLSAFLITRFGQRSLFLVAMFCFTLG 92  Bacillus subtil...
WP_010880661  14 IFLTVSLMVGVFMAILDTTIVDIIVPRLTGPLSTDLYGVQWVITSYMTAAATGILLVEWLESRIGLKKVFLIGLFLFTTS 93  Aquifex aeolicus
WP_004595873  16 LLAFFGMIVGMFMSVLDIQIVASSLSVIAAGLAASSDELSWVQTSYLIAEVIIIPITGFLARLLSTRICYFIAALGFTIM 95  Rickettsia prow...
WP_031681294  42 LRTAGVCVLASVMAHVDVTVVSVAQRTFVADFGSTQAVVAWTMTGYMLALATVIPTAGWAADRFGTRRLFMGSVLAFTLG 121 Mycobacterium t...
P27304        93 SWACGVSSSLNMLIFFRVIQGIVAGPLIPLSQSLLLNNYPPAKRSIALALWSMTVIVAPICGPILGGYISDNYHWGWIFF 172 Escherichia coli
P44927        97 SWLCGIADSLEALIIFRVIQGAVAGPVIPLSQSLLLNNYPPEKRGMALAFWSMTIVVAPIFGPILGGWISDNIHWGWIFF 176 Haemophilus inf...
P54585        93 TLVCGIAPNFSTMLIGRLIQAVGGGILQPLVMTTILLIFPPESRGKGMGIFGLAMMFAPAVGPTLSGWIIEHYTWRIMFY 172 Bacillus subtil...
WP_010880661  94 SFFAGRANSLEWMITARTFQGFGESLIVVSAEAMLFSAYPPYKRGLAMGIYGLGVSFAPALGPTLGGWITELIEWRWVFY 173 Aquifex aeolicus
WP_004595873  96 SVLCSLANNIESMIIFRALQGFFGGAMIPLVFSTVYIIFPASQRPTVTILIGLVVTVAPTLGPTLGGYITEILSWHFMFL 175 Rickettsia prow...
WP_031681294 122 SLLCAVAPNILLLIIFRVVQGFGGGMLTPVSFAILAREAGPKRLGRVMAVVGIPMLLGPVGGPILGGWLIGAYGWRWIFL 201 Mycobacterium t...
P27304       173 INVPIGVAVVLMTLQTLRGrETR--TERRRIDAVGLALLVIGIGSLQIMLDRGKELDWFSSQEIIILTVVAVVAICFLIV 250 Escherichia coli
P44927       177 INVPIGLSVVLISWKILGSrESE--IVHQPIDKVGLVLLVLGVGCLQLMLDQGREQDWFNSNEIIILAVVAVVCLIALVI 254 Haemophilus inf...
P54585       173 GLVPIGAIVIIVAFFIFKN-MVE--PQKIKLDTLGAILSIVGFASLLYGVSEAGSDGWTDP-IVLSTVIIGAIAIVAFVV 248 Bacillus subtil...
WP_010880661 174 INIPIGIINFVSALFFLPE-HKP--KHSVSLNFISYFFISVATVSLLIVLSKGQQHGWFSSDFIVKMSFLSLFSFLFFLL 250 Aquifex aeolicus
WP_004595873 176 LNVIPGIFVCTVVFLYVNF-DKPnyQLLKNFDFLGILLMSLTLGLLQYVLEEGNKEGWLDDNLILFLSITVALGFILLII 254 Rickettsia prow...
WP_031681294 202 VNLPVGLSALVLAAIVFPR-DRP--AASENFDYMGLLLLSPGLATFLFGVSSSPARGTMADRHVLIPAITGLALIAAFVA 278 Mycobacterium t...
P27304       251 W-ELTDDNPIVDLSLFKSRNFTIG-CLCISLAYMLYFGAIVLLPQLLQEVYGYTATWAGLASAPVGIIPVILSPIIGRF- 327 Escherichia coli
P44927       255 W-ELTDDNPVVDISLFHSRNFSVG-CLCTSLAFLIYLGSVVLIPLLLQQVFHYTATWAGLAASPVGLFPILLSPIIGRF- 331 Haemophilus inf...
P54585       249 Q-QLRHDDPMLDFRVFKYDIFSLS-SVINIIITVALYTGMFLLPIYLQNLVGFTALQSGLLLLPGAIVMLIMSPISGIL- 325 Bacillus subtil...
WP_010880661 251 S-EMLSRNKLVDPEIFKIKEFTIAfLVYCLLLGFSMYQVFYLLPLFYERLKGLPTFEAGLHILPLALAVGISSPIAGVI- 328 Aquifex aeolicus
WP_004595873 255 R-ELTFINPILDLKTFLYKDFTFG-CIYSFVMGIGLYGAVYILPLFLFTIAEYDTLQIGATMMVTGVAQFLSAPLAGRMl 332 Rickettsia prow...
WP_031681294 279 HsWYRTEHPLIDMRLFQNRAVAQA-NMTMTVLSLGLFGSFLLLPSYLQQVLHQSPMQSGVHIIPQGLGAMLAMPIAGAM- 356 Mycobacterium t...
P27304       328 AHKLDMRRLVTFSFIMYAVCFYWRAyTFEPGMDFGASAWP-QFIQGFAVACFFMPLTTITLSGLPPERLAAASSLSNFTR 406 Escherichia coli
P44927       332 GYKIDMRILVTISFIVYAITFYWRAvTFEPSMTFVDVALP-QLVQGLAVSCFFMPLTTITLSGLPAHKMASASSLFNFLR 410 Haemophilus inf...
P54585       326 FDKFGPRPLAIIGLLVTVVTTYQYT-QLTIDTPYTHIMLI-YSIRAFGMSLLMMPVMTAGMNQLPARLNSHGTAMSNTLR 403 Bacillus subtil...
WP_010880661 329 SDKVSERLPLFIAVVLYLYASFFILpKFNYYTPSWESAFK-LIILGIGMGFFFAPITNLALKKLG-DKTTLGVSLMHYIR 406 Aquifex aeolicus
WP_004595873 333 GLGIDLRMMLTIGLGGFALGCHLNS-CLTPDSKFAAFILP-QFVRGFSLMFCFIPTNNIALGNMPKEKVGNASGLYNLTR 410 Rickettsia prow...
WP_031681294 357 MDRRGPAKIVLVGIMLIAAGLGTFAfGVARQADYLPILPTgLAIMGMGMGCSMMPLSGAAVQTLAPHQIARGSTLISVNQ 436 Mycobacterium t...
P27304       407 TLAGSIGTSITTTMWTNRESMHHAQLTESVN-PFNPNAQAMYSQLEGL-----G---------MTQQQASGWIAQQITNQ 471 Escherichia coli
P44927       411 TLAGSVGTSLTTFMWYNREAVHHTQLTEHIN-PYNPISQSFYHQMNQF-----G---------LSDTQTSAYLAQQITSQ 475 Haemophilus inf...
P54585       404 QISGSIGTSLITTIYTNRTTFHYSQIADKTS-TADPNFLHAFQNAVSN-----LmvnmnvsydTAKTYVYSHIYKHASLD 477 Bacillus subtil...
WP_010880661 407 FVGGSFGTALATNDIQRYMWENFQRSTEIQNeRILSEFLEKISWLFWI-----G-----------EKKVKALFYQVEQLH 470 Aquifex aeolicus
WP_004595873 411 NLGGAVGLAIISTILSNDTKIFMQYLSENIS-YTSIIALTRLDSYTELlsgkiL---------NPEQGSYLLLANKLNND 480 Rickettsia prow...
WP_031681294 437 QVGGSIGTALMSVLLT--YQFNHSEIIATAK-KVALTPESGAGRGAAV-----D----------PSSLPRQTNFAAQLLH 498 Mycobacterium t...
P27304       472 GLIISANEIFWMSAGIFLVLLGLVWFA 498 Escherichia coli
P44927       476 GFIIGANEIFWLSAMGFLGLLIVIWFA 502 Haemophilus influenzae Rd KW20
P54585       478 SNVMGINDAFMWATLFCVAGLILSIFL 504 Bacillus subtilis subsp. subtilis str. 168
WP_010880661 471 AFSDSFMRTFFVAGLWGLLGSLPIFYL 497 Aquifex aeolicus
WP_004595873 481 AFVIAINNIFNMIGLLFVFIMLLIPFT 507 Rickettsia prowazekii
WP_031681294 499 DLSHAYAVVFVIATALVVSTLIPAAFL 525 Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap