Conserved Protein Domain Family
dat

?
TIGR00709: dat 
2,4-diaminobutyrate 4-transaminases
This family consists of L-diaminobutyric acid transaminases. This general designation covers both 2.6.1.76 (diaminobutyrate-2-oxoglutarate transaminase, which uses glutamate as the amino donor in DABA biosynthesis), and 2.6.1.46 (diaminobutyrate--pyruvate transaminase, which uses alanine as the amino donor). Most members with known function are 2.6.1.76, and at least some annotations as 2.6.1.46 in current databases at time of model revision are incorrect. A distinct branch of this family contains examples of 2.6.1.76 nearly all of which are involved in ectoine biosynthesis. A related enzyme is 4-aminobutyrate aminotransferase (EC 2.6.1.19), also called GABA transaminase. These enzymes all are pyridoxal phosphate-containing class III aminotransferase. [Central intermediary metabolism, Other]
Statistics
?
PSSM-Id: 129792
View PSSM: TIGR00709
Aligned: 3 rows
Threshold Bit Score: 735.218
Threshold Setting Gi: 6685396
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P44951  15 QHFLDRQDVMESNVRSYPRKLPFAYAKAQGCWVTDVEGNEYLDFLAGAGTLALGHNHPILMQAIKDVLDSGLPLHTLDLT 94  Haemophilus influenza...
P56744  15 EYYLTRQSQMESNVRSYPRKLPLAIAKAQGCWVTDVEGTQYLDCLAGAGTLALGHNHPAVIQSIQDTLASGLPLHTLDLT 94  Acinetobacter baumannii
O06060   3 QNDLSVFNEYESEVRSYVRGFPTVFHQAKGYKLWDLDGKEYVDFFSGAGALNYGHNDENMKQKLLTYIQEDGVTHSLDMA 82  Marinococcus halophilus
P44951  95 TPLKDAFSEELLSFFP---KDKYILQFTGPSGADANEAAIKLAKTYTGRGNIIAFSGGFHGMTQGALALTGNLGAKNAVE 171 Haemophilus influenza...
P56744  95 TPLKDAFTEALLAYLPg-gKEEYCLQFCGPSGADATEAAIKLAKTYTGRSSVISFSGGYHGMTHGSLAMTGNLSAKNAVN 173 Acinetobacter baumannii
O06060  83 TKAKGEFIDAFQNIILkprNMDYKIMFPGPTGANSVESALKLARKVTGRTNVVSFTNGFHGMTIGALSVTGNKFKRNGAG 162 Marinococcus halophilus
P44951 172 NLMPGVQFMPYPHEYRCPFGIGGEAGAKAVEQYFENFIEDVESGVVKPAAVILEAIQGEGGVVSAPISFLQKVREVTQKH 251 Haemophilus influenza...
P56744 174 GLMPGVQFMPYPHEYRCPLGLGGEAGVDALTYYFENFIEDVESGVTKPAAVILEAIQGEGGVVTAPVKWLQKIREVTEKH 253 Acinetobacter baumannii
O06060 163 MPLSNTSTLPYDQFLKE---------SNNSIEYIENFLDNGGSGLDKPAAFIVETVQGEGGLNAASSEWLRSIEKICRER 233 Marinococcus halophilus
P44951 252 GILMIVDEVQAGFCRSGRMFAFEHAGIEPDIIVMSKAVGG-SLPLAVLAIRKEFDAWQPAGHTGTFRGNQLAMATGYASL 330 Haemophilus influenza...
P56744 254 NIVLILDEVQAGFARSGKMFAFEHAGIEPDVVVMSKAVGG-GLPLAVLGIKRKFDAWQPAGHTGTFRGNQLAMGTGLVVL 332 Acinetobacter baumannii
O06060 234 DIKLILDDVQAGVGRTGTFFSFEPAGIKPDFVCLSKSIGGnGSPLAITLVAPEYDKFAPGEHNGTFRGNNFAFVTGTEAL 313 Marinococcus halophilus
P44951 331 KIMRDENLAQNAQERGeyltnalrelskEYPCIGNVR-GRGLMMGIDIVDERQSKDATGAYPRDCELAAAIQKACFKNKL 409 Haemophilus influenza...
P56744 333 ETIKEQNLAQNAQERG------------EFPCIGNVR-GRGLMIGVEIVDERKPADRIGSHPADSQLAAAIQTACFNNNL 399 Acinetobacter baumannii
O06060 314 NYWKDDRLEKNVQEKSeritsflddmikKHPEMKGVRkGRGFMQGIMSPIED--------------LADNIAGRCFEHGL 379 Marinococcus halophilus
P44951 410 LLERGGRGGNVVRVLCAVNINQSECEEFIKRFKQSVVDALKVVRS 454 Haemophilus influenzae Rd KW20
P56744 400 LLEKGGRNGTVIRLLCPLIITQEECVEVIARFKKAVAEALVAVRG 444 Acinetobacter baumannii
O06060 380 IMETAGAEDEVFKLFPPITIDDEGLERGLSILQQAIEEVTAESNL 424 Marinococcus halophilus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap