1G5T


Conserved Protein Domain Family
cobA

?
TIGR00708: cobA 
Click on image for an interactive view with Cn3D
cob(I)alamin adenosyltransferase
Alternate name: corrinoid adenosyltransferase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]
Statistics
?
PSSM-Id: 129791
View PSSM: TIGR00708
Aligned: 5 rows
Threshold Bit Score: 269.338
Threshold Setting Gi: 489509678
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1G5T_A        24 AQEERGIIIVFTGNGKGKTTAAFGTAARAVGHGKNVGVVQFIKGT-WPNGErnLLEP-----------HGVEFQVMATGF 91  Salmonella ente...
WP_010884195   3 WREKLGMIHIYTGNGKGKTTAALGLALRMLGSGGKVIIIQFMKAP-KVYGE--YFMA-----------EKCNFKIESYGL 68  Pyrococcus hori...
BAM51691      36 AKAEKGLVIVHTGNGKGKTTAALGMVLRSLGHGYRVGIIQFIKGA-WEPAEkaAFTPw---------qDQLTFLALGEGF 105 Bacillus subtil...
P13040        24 AQDERGIIIVFTGNGKGKTTAAFGTATRAVGHGKKVGVVQFIKGT-WPNGErnLLEP-----------HGVEFQVMATGF 91  Escherichia coli
WP_003414539  18 ARRNMPILAVHTGEGKGKSTAAFGMALRAWNAGLDIAVFQFVKSAkWKVGEeaAFRQlgrlhdqhgigGAVEWHKMGAGW 97  Mycobacterium t...
1G5T_A        92 TWETQNREADTAa-----CMAVWQHGKRMLADPLLDMVVLDELTYMVAYDYLPLEEVISALNARPGHQTVIITGRGCHRD 166 Salmonella ente...
WP_010884195  69 PKFVHGKPDEEDik---aAKRALERAREVVKSGEWDLVILDEICVALGFGMLNIEEVKELIQEKAKNTELVLTGRYCPKE 145 Pyrococcus hori...
BAM51691     106 TWETQDRQRDQAi-----AHAAWQKALEYIRNPDYQLVLLDEVNVALKLGYLDVETVLAGLQGKPESNHVILTGRGAPQP 180 Bacillus subtil...
P13040        92 TWDTQNRESDTAa-----CREVWQHAKRMLADSSLDMVLLDELTYMVAYDYLPLEEVVQALNERPHQQTVIITGRGCHRD 166 Escherichia coli
WP_003414539  98 SWTRTSRKAGTDvdraaaAADGWAEIALRLATQRHDFYLLDEFTYPLKWGWLDVDEVVDVLRARPGHQHVVITGRDAPQR 177 Mycobacterium t...
1G5T_A       167 ILDLADTVSELRPVKHAF-DAGVKAQMGIDY 196 Salmonella enterica subsp. enterica serovar Typhimurium
WP_010884195 146 LYELADYVTEMREIKHPY-QRGILARRGVEY 175 Pyrococcus horikoshii
BAM51691     181 LIDRADLVTEMTLIKHPFrEQNVKAQPGIEF 211 Bacillus subtilis BEST7613
P13040       167 ILELADTVSELRPVKHAF-DAGVKAQIGIDY 196 Escherichia coli
WP_003414539 178 LVAAADLVTEMTKVKHPM-DAGRKGQKGIEW 207 Mycobacterium tuberculosis complex
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap