Conserved Protein Domain Family
TIGR00703

?
TIGR00703: TIGR00703 
TIGR00703 family protein
The function of this family is unknown. These proteins are from 222 to 233 residues in length, lack hydrophobic stretches, and are found so far only in thermophiles. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129786
View PSSM: TIGR00703
Aligned: 3 rows
Threshold Bit Score: 351.459
Threshold Setting Gi: 11387261
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58858   7 EVEMINTLVFETLGNPEKEREFKLKSLKRWGFDLIFGKVDGKETYFTVELDeRKAGDKFSKDGKEYEVIEVLQELPKNTE 86  Methanocaldococcus ja...
O66958   8 EKIALNTLVFETLGQPEKEREFTIQDLRRWGFDLILGKKNGVRTFFASQAG-REVGDKWEEGGATYEIEEILLELPENKK 86  Aquifex aeolicus VF5
O59052   2 IKMLEGYYIIENPGVVPAERRFRMKDLKAWGYDLHLGTIEGERAYFISKTGeRHEGETYIFKGKEYHVSRTQKEIPENAR 81  Pyrococcus horikoshii...
Q58858  87 LYAHIEMEMGKAYIVCQLRdEDGKNTEVLRVPAATLLLAFLKKNKLANIIKAIKNVGISLELSMQNGV-GGKPLSYEELP 165 Methanocaldococcus ja...
O66958  87 LFAHIETSEGVAYIVAELR-EGKENLEILRTPAPTLLMAFFKKHRLHELANNLKSVGVITEFYKQRGR-ESLPLPYKKLP 164 Aquifex aeolicus VF5
O59052  82 LLARIIIERGNPYLEVWLE-EEDVKFPLTKEDPRIILKRIWEKEKLNQLLKHVRAVGLTTDFYKDNVFtQGIPLPYEEYP 160 Pyrococcus horikoshii...
Q58858 166 NVARRFIRSARKVEK-ETGFGRLSFAYYGETKDGEPRYRFSWLLPTIALFDLDIAKKVEQTLGILK 230 Methanocaldococcus jannaschii DSM 2661
O66958 165 LVARDFLERAKKVEK-MAGFGRVALAYFGKTREKDNRFRVSWLLPTIALFDIDISEKANTALEEFK 229 Aquifex aeolicus VF5
O59052 161 PKVRRVLREVKDIHRdLTGFGRFVFQYFGEVDKMHN-YRLYWTLPTLHLFDIDIANEVDKVLGMLD 225 Pyrococcus horikoshii OT3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap