Conserved Protein Domain Family
GABAtrnsam

?
TIGR00700: GABAtrnsam 
4-aminobutyrate aminotransferase, prokaryotic type
This enzyme is a class III pyridoxal-phosphate-dependent aminotransferase. This model describes known bacterial examples of the enzyme. The best archaeal matches are presumed but not trusted to have the equivalent function. The degree of sequence difference between this set and known eukaryotic (mitochondrial) examples is greater than the distance to some proteins known to have different functions, and so separate models are built for prokaryotic and eukaryotic sets. E. coli has two isozymes. Alternate names include GABA transaminase, gamma-amino-N-butyrate transaminase, and beta-alanine--oxoglutarate aminotransferase. [Central intermediary metabolism, Other]
Statistics
?
PSSM-Id: 129783
View PSSM: TIGR00700
Aligned: 3 rows
Threshold Bit Score: 667.738
Threshold Setting Gi: 2492856
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q50632  24 HRRAAAVSSGVGVTLPVFVARAGGGIVEDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRTQVAEFTHTCFMVTPYEGYVA 103 Mycobacterium tubercu...
P94427  15 QKRDQFVSKGVSNGNRSLAVKGEGAELYDLDGRRFIDFAGAIGTLNVGHSHPKVVEAVKRQAEELIHPGFNVMMYPTYIE 94  Bacillus subtilis sub...
P50457   8 QRRLSATPRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTAYQIVPYESYVT 87  Escherichia coli K-12
Q50632 104 VAEQLNRITPGSGPKRSVLFNSGAEAVENAVKIARSYTGKPAVVAFDHAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYR 183 Mycobacterium tubercu...
P94427  95 LAEKLCGIAPGSHEKKAIFLNSGAEAVENAVKIARKYTKRQGVVSFTRGFHGRTNMTMSMTSKVKPYKFGFGPFAPEVYQ 174 Bacillus subtilis sub...
P50457  88 LAEKINALAPVSGQAKTAFFTTGAEAVENAVKIARAHTGRPGVIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYH 167 Escherichia coli K-12
Q50632 184 APLSYPYRDGLLDKQLATNG-ELAAARAIGVIDkqVGANNLAALVIEPIQGEGGFIVPAEGFLPALLDWCRKNHVVFIAD 262 Mycobacterium tubercu...
P94427 175 APFPYYYQKPAGMSDESYDDmVIQAFNDFFIAS--VAPETVACVVMEPVQGEGGFIIPSKRFVQHVASFCKEHGIVFVAD 252 Bacillus subtilis sub...
P50457 168 VPYPSDLHGIST--QDSLD-----AIERLFKSD--IEAKQVAAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIAD 238 Escherichia coli K-12
Q50632 263 EVQTGFARTGAMFACEHEGPdglEPDLICTAKGIADGLPLSAVTGRAEIMNAPHVGGLGGTFGGNPVACAAALATIATIE 342 Mycobacterium tubercu...
P94427 253 EIQTGFARTGTYFAIEHFDV---VPDLITVSKSLAAGLPLSGVIGRAEMLDAAAPGELGGTYAGSPLGCAAALAVLDIIE 329 Bacillus subtilis sub...
P50457 239 EVQSGFARTGKLFAMDHYAD---KPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGNPLAVAAAHAVLNIID 315 Escherichia coli K-12
Q50632 343 SDGLIERARQIERLVTDRLTTLQAVDDRIGDVRGRGAMIAVELV-KSGTTEPDAGLTERLATAAHAAGVIILTCGMFGNI 421 Mycobacterium tubercu...
P94427 330 EEGLNERSEEIGKIIEDKAYEWKQEFPFIGDIRRLGAMAAIEIVkDPDTREPDKTKAAAIAAYANQNGLLLLTAGINGNI 409 Bacillus subtilis sub...
P50457 316 KESLCERANQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAVEFN-DPQTGEPSAAIAQKIQQRALAQGLLLLTCGAYGNV 394 Escherichia coli K-12
Q50632 422 IRLLPPLTIGDELLSEGLDIVCAILAD 448 Mycobacterium tuberculosis
P94427 410 IRFLTPLVISDSLLNEGLSILEAGLRA 436 Bacillus subtilis subsp. subtilis str. 168
P50457 395 IRFLYPLTIPDAQFDAAMKILQDALSD 421 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap