1OHV


Conserved Protein Domain Family
GABAtrns_euk

?
TIGR00699: GABAtrns_euk 
Click on image for an interactive view with Cn3D
4-aminobutyrate aminotransferase, eukaryotic type
This enzyme is a class III pyridoxal-phosphate-dependent aminotransferase. This model describes known eukaryotic examples of the enzyme. The degree of sequence difference between this set and known bacterial examples is greater than the distance between either set the most similar enzyme with distinct function, and so separate models are built for prokaryotic and eukaryotic sets. Alternate names include GABA transaminase, gamma-amino-N-butyrate transaminase, and beta-alanine--oxoglutarate aminotransferase. [Central intermediary metabolism, Other]
Statistics
?
PSSM-Id: 129782
View PSSM: TIGR00699
Aligned: 5 rows
Threshold Bit Score: 862.594
Threshold Setting Gi: 1730199
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1OHV_A     6 KVDVEFDYDGPLMKTE-VPGPRSRELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPAL 84  pig
P14010    34 KPYFPNEPTAPKLATA-IPGPKNKAASEQLNEVFDVRSLNMLADYTKSVGNYIADLDGNMLLDVYAQIASIPVGYNNPHL 112 Aspergillus nidulan...
O13837    11 THFFPNEPQGPSIKTEtIPGPKGKAAAEEMSKYHDISAVKFPVDYEKSIGNYLVDLDGNVLLDVYSQIATIPIGYNNPTL 90  Schizosaccharomyces...
AAA70415  34 KVTFEFDYDGPLMKTE-VPGPRSQELMKQLNTIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPAL 112 Norway rat
P17649     5 EQYYPEEPTKPTVKTEsIPGPESQKQLKELGEVFDTRPAYFLADYEKSLGNYITDVDGNTYLDLYAQISSIALGYNNPAL 84  Saccharomyces cerev...
1OHV_A    85 VKLVQQPQNVSTFINRPALGILPPENFVEKLREsLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYRSKERG--QSAFS 162 pig
P14010   113 LKVAASPEMATSLINRPALGNFPSADWAHILKTgILKVAPKGLDQVFTAMAGSDANETAYKAAFMYYRQQQRGgpEKEFT 192 Aspergillus nidulan...
O13837    91 LKAAKSDEVATILMNRPALGNYPPKEWARVAYEgAIKYAPKGQKYVYFQMSGSDANEIAYKLAMLHHFNNKPRp-TGDYT 169 Schizosaccharomyces...
AAA70415 113 AKLVQQPQNASTFINRPALGILLQRTLWTSSGSpCSRWLPKACVSSSRWPAGPAPMRMAFKTIFMWYRSKERG--QRGFS 190 Norway rat
P17649    85 IKAAQSPEMIRALVDRPALGNFPSKDLDKILKQ-ILKSAPKGQDHVWSGLSGADANELAFKAAFIYYRAKQRGy-DADFS 162 Saccharomyces cerev...
1OHV_A   163 KEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKENQQEEARCL 242 pig
P14010   193 EEEIQSSMLNQTPGSPQLSIMSFKAGFHGRLFGSLSTTRSKPIHKLDIPAFDWPQAPFPSLKYPLEEHAKENAEEEQRCL 272 Aspergillus nidulan...
O13837   170 AEENESCLNNAAPGSPEVAVLSFRHSFHGRLFGSLSTTRSKPVHKLGMPAFPWPQADFPALKYPLEEHVEENAKEEQRCI 249 Schizosaccharomyces...
AAA70415 191 KEELETCMVNQSPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVTDNQQEEARCL 270 Norway rat
P17649   163 EKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTTCSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDHCL 242 Saccharomyces cerev...
1OHV_A   243 EEVEDLIVKYRKKkktVAGIIVEPIQSEGGDNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGLDDPA 322 pig
P14010   273 QEAERLIKEWHNP---VAAIIVEPIQSEGGDNHASPAFFRGLREITKRNNVLFIVDEVQTGVGATGKFWAHDHWNLETPP 349 Aspergillus nidulan...
O13837   250 DQVEQILTNHHCP---VVACIIEPIQSEGGDNHASPDFFHKLQATLKKHDVKFIVDEVQTGVGSTGTLWAHEQWNLPYPP 326 Schizosaccharomyces...
AAA70415 271 EEVEDLNVKYRKKkrtVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPA 350 Norway rat
P17649   243 AIVEELIKTWSIP---VAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTGVGATGKLWCHEYADIQPPV 319 Saccharomyces cerev...
1OHV_A   323 DVMTFSKKMMTGG-FFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLSNAAHAGKVLLTGLLDLQARYPQF 401 pig
P14010   350 DMVTFSKKAQTAGyYFGNPALRPNKPYRQFNTWMGDPSRALIFRGIIEEIERLFLVENTAATGDYLYSGLERLAKQYPEH 429 Aspergillus nidulan...
O13837   327 DMVTFSKKFQAAGiFYHDLALRP-HAYQHFNTWMGDPFRAVQSRYILQEIQDKDLLNNVKSVGDFLYAGLEELARKHPGK 405 Schizosaccharomyces...
AAA70415 351 DVMSFSKKMMTGG-FFHKEEFRPSAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNVAHAGKTLLTGLLDLQARYPQF 429 Norway rat
P17649   320 DLVTFSKKFQSAGyFFHDPKFIPNKPYRQFNTWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPEN 399 Saccharomyces cerev...
1OHV_A   402 ISRVR--GRGTFCSFDTPdesIRNKLISIARNKGVMLGGCGDKSIRFRPTLVFRDHHAHLFLNIFSDIL 468 pig
P14010   430 LQNLRgkGQGTFIAWDTP---KRDEFLVKGKGVGINIGGSGQNAVRLRPMLIFQKHHADILLESIEKII 495 Aspergillus nidulans FGSC A4
O13837   406 INNLRgkGKGTFIAWDCEspaARDKFCADMRINGVNIGGCGVAAIRLRPMLVFQKHHAQILLKKIDELI 474 Schizosaccharomyces pombe 972h-
AAA70415 430 VSRVR--GRGTFCSFDTPdeaIRNKLILIARNKGVVLGGCGDKSIRFRPTLVFRDHHAQLFLNIFSGIL 496 Norway rat
P17649   400 FQNLRgkGRGTFIAWDLPtgeKRDLLLKKLKLNGCNVGGCAVHAVRLRPSLTFEEKHADIFIEALAKSV 468 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap