Conserved Protein Domain Family
TIGR00698

?
TIGR00698: TIGR00698 
conserved hypothetical integral membrane protein
Members of this family are found so far only in one archaeal species, Archaeoglobus fulgidus, and in two related bacterial species, Haemophilus influenzae and Escherichia coli. It has 9 GES predicted transmembrane regions at conserved locations in all members. These proteins have a molecular weight of approximately 35 to 38 kDa. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129781
View PSSM: TIGR00698
Aligned: 3 rows
Threshold Bit Score: 374.622
Threshold Setting Gi: 499181578
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P33019        14 WHFIPGLALSAVITGVALWGGSIPAVAGAGFSALTLAILLGMVLGNTIYPHIWKSCDGGVLFAKQYLLRLGIILYGFRLT 93  Escherichia coli
P45290         4 RPFYFGLIFIAIIAVLANYLGSTDFSHHYHISALIIAILLGMAIGNTIYPQFSSQVEKGVLFAKGTLLRAGIVLYGFRLT 83  Haemophilus inf...
WP_010879118  14 LPVSRKNLQMLLLLLLCGAAAYIINLADPALEPLFLALVFGIVAGN---LQRDEEKKRVVERYVPFLLPIGITLYGVNIN 90  Archaeoglobus f...
P33019        94 FSQIADVGISGIIIDVLTLSSTFLLACFLGQKVFGLDKHTSWLIGAGSSICGAAAVLATEPVVKAEASKVTVAVATVVIF 173 Escherichia coli
P45290        84 FGDIADVGLNAVVTDAIMLISTFFLTALLGIRYLKMDKQLVYLTGAGCSICGAAAVMAAEPVTKAESHKVSVAIAVVVIF 163 Haemophilus inf...
WP_010879118  91 IPYLGEFHP-EIVAATLISTSLIFLTVFWLSSRLKLSRQMSILLACGSGICGVSAIAIISPLIKPRKEEFSAAIMIITAV 169 Archaeoglobus f...
P33019       174 GTVAIFLYPAIYPLMSQWFSPETFGIYIGSTVHEVAQVVAAGHAISPDAENAAVISKMLRVMMLAPFLILLAARVKQLSG 253 Escherichia coli
P45290       164 GTLSIFTYPFFYTWSQHLINAHQFGIYVGSSVHEVAQVYAIGGNIDPIVANTAVITKMLRVMMLAPFLFMLSWLLTRSDG 243 Haemophilus inf...
WP_010879118 170 GLTGAILYPSIAHYAS--ISPDEFAVLAGATLHQTGIVKISSQLFG--VEEEALAIKGIRIAMIALVVLILSIIYS---- 241 Archaeoglobus f...
P33019       254 ANSGEKSKITIPWFAILFIVVAIFNSFHLLPQSVVNMLVTLDTFLLAMAMAALGLTTHVSALKKAGAKPLLMALVLFAWL 333 Escherichia coli
P45290       244 ISENTSHKITIPWFAVLFIGVAIFNSFDLLPKELVKLFVEIDSFLLISAMAALGLTTQASAIKKAGLKPLVLGVLIYLWL 323 Haemophilus inf...
WP_010879118 242 ----E-SRFYVPWYIVSFLGVALFSST-YLPGEVVQALRPLATVMFATTLAAICYTVNVGRVQRVGVKPLFASYAG--WA 313 Archaeoglobus f...
P33019       334 IVGGGAINYVIQSVI 348 Escherichia coli
P45290       324 VIGGFLVNYGISKLI 338 Haemophilus influenzae Rd KW20
WP_010879118 314 VGVAFVLLLLGSGAL 328 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap