Conserved Protein Domain Family
TIGR00697

?
TIGR00697: TIGR00697 
conserved hypothetical integral membrane protein
All known members of this family are proteins or 210-250 amino acids in length. Conserved regions of hydrophobicity suggest that all members of the family are integral membrane proteins. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129780
View PSSM: TIGR00697
Aligned: 9 rows
Threshold Bit Score: 184.849
Threshold Setting Gi: 499168525
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD18370      29 RGKAWLTGWLSLlSSIMNVFVLKQIH------------LWGFEVTSADVYVIGLLTCLNYAREHYEKNDINDAMLCSWVI 96  Chlamydophila p...
P54163        25 FGKMGLFVWIGFaTVCANLQVVKTVE------------LFGLTATLGNVMYGTIFFATDVLNEKYGPAEARKAVWLGFST 92  Bacillus subtil...
P44908        15 RAIIWLSFFHIFiIAASNYFVQIPFEitlkltalgaanDFSFHSTWGTLTFPFIFLATDLTVRIFGAEDARKIIFVVMFP 94  Haemophilus inf...
P37619        11 KALFWLSLFHLLvITSSNYLVQLPVS------------ILGFHTTWGAFSFPFIFLATDLTVRIFGAPLARRIIFAVMIP 78  Escherichia col...
WP_010879601  25 FGRTGLYAWTAMaIILANIQVMKTIR------------FFGLVTAMGNIVYGTTFLVTDILCENYGKREAKKAVEVGFFV 92  Archaeoglobus f...
WP_010725089  24 RNLIMLAAWASLlSIIMNIFVLKQIV------------LFGFEVTAADVYVIGLFSCLNCAREFWGKESTRKVIFVSWCS 91  Chlamydia trach...
WP_010889667  25 FKKNGLFAWVAVaIIIANIQVLKQIT------------IFGINATLGNIIYTSSYIATDMLSEFYGEKTSKKAVYIGFIS 92  Lyme disease sp...
WP_010892187  14 sylsstftlllvlsnlvlsskLIPTT------------FFNFIIPGGLILYPLTFLISDVVNEIFGPKKARVMIFSAFIA 81  Chlamydia pneum...
WP_010866801  13 PLVLAAAVF-SVaLVSANYLSAKLFLvei-------pgLITLVGPAGVVAYSVTFIVTDVVSEVYGRRAAGAVVAAGFAS 84  Aeropyrum pernix
AAD18370      97 SIAFLVLTQLHLFLIPSPNDSSQ-EHFLALFSSTPRIVVASLVTLIFVQIVDIKLFTFLQRVFSK-KYFAMRSTISLLFS 174 Chlamydophila p...
P54163        93 LLTLTFVMQGVLLFEPASSDISQ-TALETIFGFLPRVALGSLLAFIFSQTLDVYVYSAIRRIFPSdRLLWLRNGGSTAVS 171 Bacillus subtil...
P44908        95 ALIVSYVISVLFSESKFQGFESL-THFD-LFVF--RIAIASFAAYVVGQLLDVIVFNRLRQL----KTWWVAPTSSMTFG 166 Haemophilus inf...
P37619        79 ALLISYVISSLFYMGSWQGFGAL-AHFN-LFVA--RIATASFMAYALGQILDVHVFNRLRQS----RRWWLAPTASTLFG 150 Escherichia col...
WP_010879601  93 LVVFTLLMQICLAFIPHESDTLS-PHLEQIFGIMPRITVASLTAYLVSQLHDVWAFDFWKRRTKG-RFLWLRNNASTMVS 170 Archaeoglobus f...
WP_010725089  92 TLSFLILTQLHLHLKPSPGDISQ-LHYEALFAPSLRIISASVITTMIVQFVDFKVFGWLKKHSQG-RVFGLRSACSVALS 169 Chlamydia trach...
WP_010889667  93 FIIFAVLTNAQIHFMSNRTQENF-KSLGNIFSSMPALLLASLVAYLISQLNDVYLYQLIKKKFP--RFLFFRTNGSTLIS 169 Lyme disease sp...
WP_010892187  82 NLLASSIVQIFMFF-PVASPEMQ-TAWHCLFDLSPLRFLASLLAFIVSQQLDIVLYTFFKNRTPN-SSLWLRSNGSTWIS 158 Chlamydia pneum...
WP_010866801  85 QIVALFLTAVAIASPPAPFSLVQqEEYAKVVMAGFNIIVASLVAYIVSQYHDVWAFHFWKKMTGS-RWLWLRNNLSTWVS 163 Aeropyrum pernix
AAD18370     175 QLIDTIIFSFLGLYG--------------LVSNLCDVMIFAMLVKGIVITLAIPTLTVTKAVLDRR 226 Chlamydophila pneumoniae CWL029
P54163       172 QLFDTFIFTAVAFLGi------------yPADVWLHIFISTYLIKFAVSLISLPYAYAAKKMIPND 225 Bacillus subtilis subsp. subt...
P44908       167 SMADTFVFFSIAFYQsad---------pfMAEHWAQLGFVDYLFKLFIGIILFVPAYGVVLNVILR 223 Haemophilus influenzae Rd KW20
P37619       151 NVSDTLAFFFIAFWRspd---------afMAEHWMEIALVDYCFKVLISIVFFLPMYGVLLNMLLK 207 Escherichia coli K-12
WP_010879601 171 QLIDNAVFTWIAFVGfgvfw-----eqvfPWELIAEIFVTSYIMKFIVAALDTPFVYIAKMIKSEA 231 Archaeoglobus fulgidus
WP_010725089 170 QSIDTVIFSFLGLYG--------------LVANLPDVMMFSLLSKGTALLLASPCVALAKVFYNRL 221 Chlamydia trachomatis
WP_010889667 170 GLIDTTIFVGIATYFkv-----------fPKQAFLNIVIFTYVIKAVAGVLGTPFIYFAKYIKLEK 224 Lyme disease spirochete
WP_010892187 159 QIPDTFIVDTCILYFgm----------glSFPQTLNIMFYSYIYKITFCVLTTPLFYLAVNTIRKF 214 Chlamydia pneumoniae
WP_010866801 164 QLIDTVVFLSLAFYIipllspeasrvepvSLSTLWAMIYSQYIIKLGIAVLDTPVVYLGVYLVKNY 229 Aeropyrum pernix
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap