Conserved Protein Domain Family
wecG_tagA_cpsF

?
TIGR00696: wecG_tagA_cpsF 
bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family
The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in enterobacterial common antigen (eca) synthesis in Escherichia coli. Another family member, the Bacillus subtilis TagA protein, is involved in the biosynthesis of the cell wall polymer poly(glycerol phosphate). The third family member, CpsF, CMP-N-acetylneuraminic acid synthetase has a role in the capsular polysaccharide biosynthesis pathway. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 129779
View PSSM: TIGR00696
Aligned: 4 rows
Threshold Bit Score: 281.679
Threshold Setting Gi: 2851574
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P27836        60 ELINAAEFKYADGISVVRSVRKKYPqAQVSRVAGADLWEELMARAGKEGT--PVFLVGGKPEVLAQTEAKLRNQWNVNIV 137 Escherichia col...
P27620        55 DVLSSSNFILPDGIGVVMMSRLTNN-RLQSRIAGYDVFKELLGVANKKKK--RIFLYGAKKDVIKGVVSKISSEYPNIKI 131 Bacillus subtil...
WP_010872894  61 EVIQGAELVIPDGAGVTIYLKLEG--IEQSRCPGIELAEAMVRHIGEGKDnqPIAFYGGAPGITELAAQRWQREYPGLKI 138 Synechocystis s...
BAM50333      59 EIINQAVLVTPDGMPLVWGLKLLGY-PQATRVYGPDLMLTICQRAAAENL--GIYLYGGTEDCLQQLKVNLIKRFPKLKI 135 Bacillus subtil...
P27836       138 GSQ----DGYFKPEqRQALFERIHASGAQIVTVAMGSPKQEIIMRDCRLVHPDALYMGVGGTYDVFTGHVKRAPKIWQTL 213 Escherichia col...
P27620       132 AGY----SDGYVQD-RTLVAKQIARANPDMVFVALGYPHQEKFIHNYRHLFPKAVSIGLGGSFDVFSGNVKRAPSWMIRL 206 Bacillus subtil...
WP_010872894 139 LAN----HGFLTESeQDAWQQTLARERPCLILVGLGVPRQEYWIRDHRHLCPQGIWIGVGGSFDVWSGTKQRAPEFFCRY 214 Synechocystis s...
BAM50333     136 VGAdsppFRPLEPEeEKNALAKIKQSGAGILFVGLGCPKQEIWMANH-YQKIDLVMVGVGAAFNFHSGLVSQAPRWLMAM 214 Bacillus subtil...
P27836       214 GLEWLYRLLSQPSRIKRQLRLLRY 237 Escherichia coli K-12
P27620       207 NLEWFYRLILNPWRWKRMLSIPKY 230 Bacillus subtilis subsp. subtilis str. 168
WP_010872894 215 NLEWFYRLYQEPWRWRRMLALPKF 238 Synechocystis sp. PCC 6803
BAM50333     215 GLEWLYRLRMEPKRLWRRYLINNP 238 Bacillus subtilis BEST7613
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap