4EAC


Conserved Protein Domain Family
uxuA

?
TIGR00695: uxuA 
Click on image for an interactive view with Cn3D
mannonate dehydratase
This Fe2+-requiring enzyme plays a role in D-glucuronate catabolism in Escherichia coli. Mannonate dehydratase converts D-mannonate to 2-dehydro-3-deoxy-D-gluconate. An apparent equivalog is found in a glucuronate utilization operon in Bacillus stearothermophilus T-6. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 129778
View PSSM: TIGR00695
Aligned: 4 rows
Threshold Bit Score: 619.299
Threshold Setting Gi: 7531224
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4EAC_A  21 MEQTWRWYGP-NDPVSLADVRQA-GATGVVTALHHIPNGEVWSVEEILKRKAIIEDAGLVWSVVESVPIHEDIKTHTGNY 98  Escherichia coli K-12
P44488   1 MEQAWRWYGP-KDPVSLSDIRQA-GATGIVTALHHIPNGEIWGIEEIKKRKTEIENAGLSWSVVESVPVHEEIKTQTGNY 78  Haemophilus influenza...
O34346   1 MNMTFRWYGRgNDTVTLEYVKQIpGVKGIVWALHQKPVGDVWEKEEIRAETEYIQSYGFHAEVVESVNVHEAIKLGNEER 80  Bacillus subtilis sub...
P24215   1 MEQTWRWYGP-NDPVSLADVRQA-GATGVVTALHHIPNGEVWSVEEILKRKAIIEDAGLVWSVVESVPIHEDIKTHTGNY 78  Escherichia coli K-12
4EAC_A  99 EQWIANYQQTLRNLAQCGIRTVCYNFMPVLDWTRTDLEYVLPDGSKALRFDQIEFAAFEMHILKRPGAEADYTEEEIAQA 178 Escherichia coli K-12
P44488  79 QKWINNYKQTLRNLAQCGIDTVCYNFMPVLDWTRTDLAYELPDGSKALRFDHIAFAAFELHILKRPDAEKTYNQEEQVAA 158 Haemophilus influenza...
O34346  81 GRYIENYKQTIRNLAGFGVKVICYNFMPVFDWTRTDMFRPLEDGSTALFFEKAKVESLD------P--------QELIRT 146 Bacillus subtilis sub...
P24215  79 EQWIANYQQTLRNLAQCGIRTVCYNFMPVLDWTRTDLEYVLPDGSKALRFDQIEFAAFEMHILKRPGAEADYTEEEIAQA 158 Escherichia coli K-12
4EAC_A 179 AERFATMSDEDKARLTRNIIAGLPGAEEGYTLDQFRKHLELYKDIDKAKLRENFAVFLKAIIPVAEEVGVRMAVHPDDPP 258 Escherichia coli K-12
P44488 159 RTYYDNMSEQDIAQLTRNIIAGLPGAEEGYTLDEFQTQLDRYKDISSEKFRTHLAYFLNEIVPVAQEIGIKMAIHPDDPP 238 Haemophilus influenza...
O34346 147 VEEASDMT--------------LPGWEP-EKLARIKELFAAYRTVDEEKLWDNLSFFLQEILPVAEAYGVQMAIHPDDPP 211 Bacillus subtilis sub...
P24215 159 AERFATMSDEDKARLTRNIIAGLPGAEEGYTLDQFRKHLELYKDIDKAKLRENFAVFLKAIIPVAEEVGVRMAVHPDDPP 238 Escherichia coli K-12
4EAC_A 259 RPILGLPRIVSTIEDMQWMVDTVNSMANGFTMCTGSYGVRADNDLVDMIKQFGPRIYFTHLRSTMREDNPKTFHEAAHLN 338 Escherichia coli K-12
P44488 239 RPILGLPRIVSTIEDMQWFVETQPLPANGFTMCTGSYGVRSDNDLVKMTEQFADRIYFAHLRSTQREGNPLTFHEAAHLE 318 Haemophilus influenza...
O34346 212 WPIFGLPRIITGEASYKKLRAISDSPSNCITLCTGSMGANPANDMVEIAKTYAGIAPFSHIRNVKIYENG-DFIETSHLT 290 Bacillus subtilis sub...
P24215 239 RPILGLPRIVSTIEDMQWMVDTVNSMANGFTMCTGSYGVRADNDLVDMIKQFGPRIYFTHLRSTMREDNPKTFHEAAHLN 318 Escherichia coli K-12
4EAC_A 339 GDVDMYEVVKAIVEEEHRRKAEGKEDLIPMRPDHGHQMLDDLKKKTNPGYSAIGRLKGLAEVRGVELAIQRAFFSR 414 Escherichia coli K-12
P44488 319 GDVDMFNVVKALLNEEYRRLNQGETRLIPMRPDHGHQILDDLRKKTNPGYSAIGRLKGLAEFRGLEMALKKVYFNK 394 Haemophilus influenzae Rd...
O34346 291 KDGSIN--IQGVMEELHKQDYEG----Y-VRPDHGRHLWG---EQCRPGYGLYDRALGIMYLNGLWDAYEAMAKKE 356 Bacillus subtilis subsp. ...
P24215 319 GDVDMYEVVKAIVEEEHRRKAEGKEDLIPMRPDHGHQMLDDLKKKTNPGYSAIGRLKGLAEVRGVELAIQRAFFSR 394 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap