2D8A


Conserved Protein Domain Family
tdh

?
TIGR00692: tdh 
Click on image for an interactive view with Cn3D
L-threonine 3-dehydrogenase
This protein is a tetrameric, zinc-binding, NAD-dependent enzyme of threonine catabolism. Closely related proteins include sorbitol dehydrogenase, xylitol dehydrogenase, and benzyl alcohol dehydrogenase. Eukaryotic examples of this enzyme have been demonstrated experimentally but do not appear in database search results.E. coli His-90 modulates substrate specificity and is believed part of the active site. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 129775
View PSSM: TIGR00692
Aligned: 4 rows
Threshold Bit Score: 603.771
Threshold Setting Gi: 109157454
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2D8A_A   7 AIXKTKPGYGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIKPPQIXGHEVAGEVVEIGPGVEGIEVG 86  Pyrococcus horikoshii...
P07913   3 ALSKLKAEEGIWMTDVPVPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMVVGHEYVGEVVGIGQEVKGFKIG 82  Escherichia coli K-12
O31776   8 ALMKKDGAFGAVLTEVPIPEIDKHEVLIKVKAASICGTDVHIYNWDQWARQRIKTPYVFGHEFSGIVEGVGENVSSVKVG 87  Bacillus subtilis sub...
O58389   7 AIMKTKPGYGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIKPPQIMGHEVAGEVVEIGPGVEGIEVG 86  Pyrococcus horikoshii...
2D8A_A  87 DYVSVETHIVCGKCYACRRGQYHVCQNTKIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYATLQEPLGNAVDTVLAGPI 166 Pyrococcus horikoshii...
P07913  83 DRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLAAIFDPFGNAVHTALSFDL 162 Escherichia coli K-12
O31776  88 EYVSAETHIVCGECVPCLTGKSHVCTNTAIIGVDTAGCFAEYVKVPADNIWRNPADMDPSIASIQEPLGNAVHTVLESQP 167 Bacillus subtilis sub...
O58389  87 DYVSVETHIVCGKCYACRRGQYHVCQNTKIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYATLQEPLGNAVDTVLAGPI 166 Pyrococcus horikoshii...
2D8A_A 167 SGKSVLITGAGPLGLLGIAVAKASGAYPVIVSEPSDFRRELAKKVGADYVINPFEEDVVKEVXDITDGNGVDVFLEFSGA 246 Pyrococcus horikoshii...
P07913 163 VGEDVLVSGAGPIGIMAAAVAKHVGARNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELGMTEGFDVGLEMSGA 242 Escherichia coli K-12
O31776 168 AGGTTAVIGCGPIGLMAVAVAKAAGASQVIAIDKNEYRLRLAKQMGATCTVSIEKEDPLKIVSALTSGEGADLVCEMSGH 247 Bacillus subtilis sub...
O58389 167 SGKSVLITGAGPLGLLGIAVAKASGAYPVIVSEPSDFRRELAKKVGADYVINPFEEDVVKEVMDITDGNGVDVFLEFSGA 246 Pyrococcus horikoshii...
2D8A_A 247 PKALEQGLQAVTPAGRVSLLGLYPGKVTIDFNnLIIFKALTIYGITGRHLWETWYTVSRLLQSgKLNLDPIITHKYKgFD 326 Pyrococcus horikoshii...
P07913 243 PPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWT-KVIFKGLFIKGIYGREMFETWYKMAALIQS-GLDLSPIITHRFS-ID 319 Escherichia coli K-12
O31776 248 PSAIAQGLAMAANGGRFHILSLPEHPVTIDLTnKVVFKGLTIQGITGRKMFSTWRQVSQLISSnMIDLAPVITHQFP-LE 326 Bacillus subtilis sub...
O58389 247 PKALEQGLQAVTPAGRVSLLGLYPGKVTIDFNnLIIFKALTIYGITGRHLWETWYTVSRLLQSgKLNLDPIITHKYKgFD 326 Pyrococcus horikoshii...
2D8A_A 327 KYEEAFELXRAGKTGKVVFXL 347 Pyrococcus horikoshii OT3
P07913 320 DFQKGFDAMRSGQSGKVILSW 340 Escherichia coli K-12
O31776 327 EFEKGFELMRSGQCGKVILIP 347 Bacillus subtilis subsp. subtilis str. 168
O58389 327 KYEEAFELMRAGKTGKVVFML 347 Pyrococcus horikoshii OT3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap