1NN4


Conserved Protein Domain Family
rpiB_lacA_lacB

?
TIGR00689: rpiB_lacA_lacB 
Click on image for an interactive view with Cn3D
sugar-phosphate isomerase, RpiB/LacA/LacB family
Proteins of known function in this family act as sugar (pentose and/or hexose)-phosphate isomerases, including the LacA and LacB subunits of galactose-6-phosphate isomerases from Gram-positive bacteria and RpiB. RpiB is the second ribose phosphate isomerase of E. coli. It lacks homology to RpiA, its inducer is unknown (but is not ribose), and it can be replaced by the homologous galactose-6-phosphate isomerase of Streptococcus mutans, all of which suggests that the ribose phosphate isomerase activity of RpiB is a secondary function. On the other hand, there appear to be a significant number of species which contain rpiB, lack rpiA and seem to require rpi activity in order to complete the pentose phosphate pathway.
Statistics
?
PSSM-Id: 129772
View PSSM: TIGR00689
Aligned: 9 rows
Threshold Bit Score: 222.254
Threshold Setting Gi: 490735054
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NN4_A        17 IAFGCDHVGFILKHEIVAHLVERGVEVIDKGTW-S-SERTDYPHYASQVALAVAGGEVD-GGILICGTGVGISIAANKFA 93  Escherichia coli
P37351         4 IAFGCDHVGFILKHEIVAHLVERGVEVIDKGTW-S-SERTDYPHYASQVALAVAGGEVD-GGILICGTGVGISIAANKFA 80  Escherichia col...
P39156         3 VAIASDHGGVHIRNEIKELMDELQIEYIDMGCD-CgSGSVDYPDYAFPVAEKVVSGEVD-RGILICGTGIGMSISANKVK 80  Bacillus subtil...
P53527         7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPT-ElDPLDDYPDYAFLLAQTMQANPNS-LGILICGTGVGVCMAANKAK 84  Mycoplasma pneu...
WP_001037678  10 VFIGSDHAGLHLAEFVQRFLEDKDFKIQ--AFL-P-TMRVDYPDYAKLVCQKVLENAQS-YGILVCATGIGMSMGANRFK 84  Helicobacter py...
P47636         5 IFIASDHTGLTLKKIISEHLKTKQFNVVDLGPN-YfDANDDYPDFAFLVADKVKKNSDKdLGILICGTGVGVCMAANKVK 83  Mycoplasma geni...
WP_010880713   3 IAIGSDHAGFPLKEKIKEFLKGEGHKVIDVGTH-A-QESTHYPIYAKEVVRAIRSGKAE-RGILICGTGIGMSITANKFR 79  Aquifex aeolicus
WP_015456396  10 VYLGADHAGYELKQRIIEHLKQTGHEPIDCGALrY-DADDDYPAFCIAAATRTVADPGS-LGIVLGGSGNGEQIAANKVP 87  Mycobacterium t...
WP_004597385   6 IVIASDHSGYELKSKIINYLEQKCLNIYDCGTQ-D-TQTVDYPDYAKKVVDIIIEKAAP-IGILISDTGIGMSIAANRSS 82  typhus group
1NN4_A        94 GIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYE-GGRHQQRVEAITAIEQR 160 Escherichia coli
P37351        81 GIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYE-GGRHQQRVEAITAIEQR 147 Escherichia coli K-12
P39156        81 GIRCALAHDTFSAKATREHNDTNILAMGERVIGPGLAREIAKIWLTTEFT-GGRHQTRIGKISDYEEK 147 Bacillus subtilis subsp. su...
P53527        85 GILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFE-GGRHSKRVGKIIAYERE 151 Mycoplasma pneumoniae M129
WP_001037678  85 GIRAALCLDAYMAKMTRLHNNANVLCLGEKISGIGVVESILEAFFSTEFE-QGRHVLRIQKLDESLKS 151 Helicobacter pylori
P47636        84 GVLAALVVSEKTAALARQHDNANVLCLSSRFVTDSENIKIVDDFLKANFE-GGRHQRRIDKIIRYEKE 150 Mycoplasma genitalium G37
WP_010880713  80 GIRAALCTNEYMARMSRLHNDANVLCLGERVLGVELALSIVKVWLETPFE-GGRHLKRLeiiseiede 146 Aquifex aeolicus
WP_015456396  88 GARCALAWSVQTAALAREHNNAQLIGIGGRMHTVAEALAIVDAFVTTPWSkAQRHQRRIDILAEYERT 155 Mycobacterium tuberculosis
WP_004597385  83 EIRAALCNDILTAENAKAHNDANILILGAKSVDNKIVFNIIDKFLTTKFE-GGRHSTRLSKIK----- 144 typhus group
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap