Conserved Protein Domain Family
rarD

?
TIGR00688: rarD 
rarD protein
This uncharacterized protein is predicted to have many membrane-spanning domains. [Transport and binding proteins, Unknown substrate]
Statistics
?
PSSM-Id: 129771
View PSSM: TIGR00688
Aligned: 3 rows
Threshold Bit Score: 309.419
Threshold Setting Gi: 2833492
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q57389     2 FKGILVSLLASFLFGYMYYFSTLLKPLSGTDIFGYRMIFTFPFVLLSVTLFKQKAALIERLKRIQKrphlALSYLLCGLL 81  Haemophilus influen...
AAA67615  11 AAGRITRSCRLFYLGYSATYFKLIYYVPADEILTHRVIWSFFFMVVLMSICRQWSYLKTLIQTPQK----IFMLAVSAVL 86  Escherichia coli st...
AAC17852   7 KKGVIYTAVSFIMWGLFPLYWKLLEQLPALDILAHRIIWSFVFMCIVLFFLRQWKIGWQELRSLKKng-gILSLFLASIL 85  Bacillus subtilis s...
Q57389    82 MGFQMWLFLWAPNNGSSLSVSFGYLLLPIVMVAAGRVFFKERISTFKFIAVIIATLGVISNIVLKGGLSWEAIVICLGYT 161 Haemophilus influen...
AAA67615  87 IGGNWLLFIWAVNNHHMLERSLGYFINPLVNIVLGMIFLGDGFRRMQWLAVILAICGVLVQLWTFGSLPIIALGLAFSFA 166 Escherichia coli st...
AAC17852  86 ISINWFVYIWAVNHGFLLEASLGYYINPLVSVLLGILFLKEKLNRLQLVAVSIAAAGVIISAFQYGSIPYVALLLAFSFG 165 Bacillus subtilis s...
Q57389   162 AYFSIRKALKNTDLASFCLEMLSLMPVSIYFALQTDFATVQQTNPF---IWGXLVLLGLISGTALIAYVIASNMLPMNLL 238 Haemophilus influen...
AAA67615 167 FYGLVRKKIAVEAQTGMLIETMWLLPVAAIYLFAIADSSTSHMGQNpmsLNLLLIAAGIVTTVPLLCFTAAATRLRLSTL 246 Escherichia coli st...
AAC17852 166 LYGLSKKRTSLPSAIGLTLETFMIMPIALGYLLFSGHVQPAGAESGg--TWLLLFLAGVFTALPLLLFAEGAKRLPLYQV 243 Bacillus subtilis s...
Q57389   239 GLLGYV-ETIMMLCVSFLI 256 Haemophilus influenzae Rd KW20
AAA67615 247 GFFQYIgPTLMFLLAVTFY 265 Escherichia coli str. K-12 substr. MG1655
AAC17852 244 GILQYIaPTITLLIGLFCL 262 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap