Conserved Protein Domain Family

TIGR00681: kdpC 
K+-transporting ATPase, C subunit
This chain has a single predicted transmembrane region near the amino end. It is part of a K+-transport ATPase that contains two other membrane-bound subunits, KdpA and KdpB, and a small subunit KdpF. KdpA is the K+-translocating subunit, KdpB the ATP-hydrolyzing subunit. During assembly of the complex, KdpA and KdpC bind to each other. This interaction is thought to stabilize the complex [MEDLINE:9858692]. Data indicates that KdpC might connect the KdpA, the K+-transporting subunit, to KdpB, the ATP-hydrolyzing (energy providing) subunit [MEDLINE:9858692]. [Transport and binding proteins, Cations and iron carrying compounds]
PSSM-Id: 129764
Aligned: 3 rows
Threshold Bit Score: 289.121
Threshold Setting Gi: 3121786
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P96369 157 ERLIEDHTDARGLGFLGERAVNVLRLNLALDRL 189 Mycobacterium tuberculosis
P73869 158 QSLITKHTEGRFLGIFGEPGVNVLTLNLALDNR 190 Synechocystis sp. PCC 6803 substr. Kazusa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap