2EHH,1DHP,2YXG


Conserved Protein Domain Family
dapA

?
TIGR00674: dapA 
Click on image for an interactive view with Cn3D
4-hydroxy-tetrahydrodipicolinate synthase
Members of this family are 4-hydroxy-tetrahydrodipicolinate synthase, previously (incorrectly) called dihydrodipicolinate synthase. It is a homotetrameric enzyme of lysine biosynthesis. E. coli has several paralogs closely related to dihydrodipicoline synthase (DapA), as well as the more distant N-acetylneuraminate lyase. In Pyrococcus horikoshii, the bidirectional best hit with E. coli is to an uncharacterized paralog of DapA, not DapA itself, and it is omitted from the seed. The putative members from the Chlamydias (pathogens with a parasitic metabolism) are easily the most divergent members of the multiple alignment. [Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 129757
View PSSM: TIGR00674
Aligned: 14 rows
Threshold Bit Score: 387.84
Threshold Setting Gi: 14547947
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2EHH_A   4 GSIVALITPFKE-GEVDYEALGNLIEFHVDNGTDAILVCGTTGESPTLTFEEHEKVIEFAVKRAAG-------RIKVIAG 75  Aquifex aeolicus VF5
P05640   4 GSIVAIVTPMDEkGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADG-------RIPVIAG 76  Escherichia coli
P43797  10 GSIVALVTPMNHyGEVDFSCLEKLVEHHIEAGSNALVSVGTTGESATLSIEENVKVIEKTVEFAKG-------RIPIIAG 82  Haemophilus influenza...
O29352   4 GVIPAMVTPFKEdFSVDYEGIAKNLDY-LEKHVNALVPAGTTGEAATLSYEEHIDVVRYVAETSK---------LPVIGG 73  Archaeoglobus fulgidu...
Q04796   5 NVSTAMITPFDNkGNVDFQKLSTLIDYLLKNGTDSLVVAGTTGESPTLSTEEKIALFEYTVKEVNG-------RVPVIAG 77  Bacillus subtilis sub...
Q55513  12 PVLTAMVTPFNAdGGVDYGVAEKLADHLITHGSDGLVVCGTTGESPTLSWEEEHELFRVVKQTVGD-------RGSVIAG 84  Synechocystis sp. PCC...
O05969   7 GLITALITPFKDnK-LDLYALENILNQQIKHKIDAVLIAGSTGEANSLSFEEYKLLLKTSVDIVNN-------RMPIISG 78  Rickettsia prowazekii...
Q9Z6K9   2 HLLTATVTPFFPnGTIDFASLERLLSFQDAVG-NGVVLLGSTGEGLSLTKKEKQALICFACDLQLK--------VPLFVG 72  Chlamydia pneumoniae
O25657   4 HSSSALITPFKKdLSVDEAAYETLIKRQIFQGMDACVPVGTTGESATLTHKEHMRCIEIAIETCKNtktpsnsRMKVLAG 83  Helicobacter pylori 2...
1DHP_A   4 GSIVAIVTPMDEkGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADG-------RIPVIAG 76  Escherichia coli IAI1
2EHH_A  76 TGGNATHEAVHLTAHAKEVGADGALVVVPYYNKPTQRGLYEHFKTVAQEV-DIPIIIYNIPSRTCVEISVDTMFKLASEC 154 Aquifex aeolicus VF5
P05640  77 TGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHT-DLPQILYNVPSRTGCDLLPETVGRLAKVK 155 Escherichia coli
P43797  83 AGANATSEAITMTKLLRDSGVAGCLSVVPYYNKPTQEGMYQHFKAIAECT-DLPQILYNVPSRTGSDMKPETVARLAEIE 161 Haemophilus influenza...
O29352  74 AGSNSTREAIWLAKEVEKAGAEAAMLVTPYYNKPNAEGLYQHYKAVASEV-SIPIIVYNVPSRTGINTTPELVRRLAEID 152 Archaeoglobus fulgidu...
Q04796  78 TGSNNTKDSIKLTKKAEEAGVDAVMLVTPYYNKPSQEGMYQHFKAIAAET-SLPVMLYNVPGRTVASLAPETTIRLAADI 156 Bacillus subtilis sub...
Q55513  85 TGSNCTREAMEATQIAAKLGVDGSLQVVPYYNKPPQEGLLAHFQAIANCApELPLMLYNIPGRTGQSLAPETVYRLA-EV 163 Synechocystis sp. PCC...
O05969  79 CSSNNTAYAIELAIESKKIGVDCFMASPPSYVKPTQHGIYKHFEALHEAC-NLPIMLYSAPTRSGVDFSDETILRLSKLP 157 Rickettsia prowazekii...
Q9Z6K9  73 TSGTLLEEVLDWIHFCNDLPISGFLMTTPIYTKPKLCGQILWFEAVLNAA-KHPAILYNIPSRAATPLYLDTVKALAHHP 151 Chlamydia pneumoniae
O25657  84 VGSNATSESLSLAKFAQKIGADAILCVSPYYNRPTQQGLFEHYKTIAQSV-EIPVMLYDVPSRTGVSIEVPTALKLFREV 162 Helicobacter pylori 2...
1DHP_A  77 TGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHT-DLPQILYNVPSRTGCDLLPETVGRLAKVK 155 Escherichia coli IAI1
2EHH_A 155 eN-IVASKESTPNMDRISEIVKRLgESFSVLSGDDSLTLPMMALGAKGVISVANNVMPREVKELIRAALEGDFRRAREIH 233 Aquifex aeolicus VF5
P05640 156 -N-IIGIKEATGNLTRVNQIKELVsDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVIN 233 Escherichia coli
P43797 162 -N-IVGIKEATRDVSRIVKIKQLAgKNFIVLSGDDATGLEAIKLGAEGVISVTNNIAAKDMADMCRYALAGDFDKAEEIN 239 Haemophilus influenza...
O29352 153 -N-IFGIKEASGNLKQISEIIRTTpDDFVLLSGDDFLTLPILCLGGKGVISVAANVAPHLMKEMYEAFVEGNIERAREMH 230 Archaeoglobus fulgidu...
Q04796 157 -PnVVAIKEASGDLEAITKIIAETpEDFYVYSGDDALTLPILSVGGRGVVSVASHIAGTDMQQMIKNYTNGQTANAALIH 235 Bacillus subtilis sub...
Q55513 164 -EnIVAIKEATGSLEQASLIRAHTpDDFAIYAGDDVLTLPLLAVGGAGVVSVASHLVGDRLQAMVQHFAQGATAQALEIH 242 Synechocystis sp. PCC...
O05969 158 -R-ILALKDCGVDLERPMRIRAIVkGDFNILTGNDEVVLAFHAQGVVGWISVTSNIAPKLCKELLEKWYNNDTQGALEIH 235 Rickettsia prowazekii...
Q9Z6K9 152 -Q-FLGIKDSGGSVEEFQSYKSIAp-HIQLYCGDDVFWSEMAACGAHGLISVLSNAWPEEAREYVLNPQEQDYRSL---- 224 Chlamydia pneumoniae
O25657 163 -PnIKAIKEASGSLKRVTELHYYE-KDFKIFSGEDSLNHSIMFSGGCGVISVTGNLMPNLISQMVNCALKQKYQQALEIQ 240 Helicobacter pylori 2...
1DHP_A 156 -N-IIGIKEATGNLTRVNQIKELVsDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVIN 233 Escherichia coli IAI1
2EHH_A 234 YYLHDLFKVLFIETNPIPVKTACWMLGMCEK-EFRLPLTEMSPENENKLREVLKKY 288 Aquifex aeolicus VF5
P05640 234 QRLMPLHNKLFVEPNPIPVKWACKELGLVATdTLRLPMTPITDSGRETVRAALKHA 289 Escherichia coli
P43797 240 ARLMRLHHDLFIESNPIPVKWAAYRLGLIKSpHLRLPLTTLSEEIQPKVGDALKIA 295 Haemophilus influenzae Rd KW20
O29352 231 HRLTPLFDVLFIDTNPIPVKKALQLMGLAAG-KPRLPLVELSEEKTQKVKEVLKSL 285 Archaeoglobus fulgidus DSM 4304
Q04796 236 QKLLPIMKELFKAPNPAPVKTALQLRGLDVG-SVRLPLVPLTEDERLSLSSTISEL 290 Bacillus subtilis subsp. subtilis str. 168
Q55513 243 LQLIPLFKILFCATNPIPVKTALGLQGWPVG-SFRPPLCALSPGHTEQLRDVLRDL 297 Synechocystis sp. PCC 6803 substr. Kazusa
O05969 236 QKLLPLYKALFLESNPIPVKYAAYYLGLCEN-EIRLPLTEASDSAKKQIKKIITSL 290 Rickettsia prowazekii str. Madrid E
Q9Z6K9 225 --WMETCRWVYTTTNPIGIKAILAYKKAITHaQLRLPLSIEDFDLENVSPAVESML 278 Chlamydia pneumoniae
O25657 241 NKLFCLHQALFVETNPIPIKMAMHLAGLIENpSYRLPLVAPSKETIQLLEKTLQQY 296 Helicobacter pylori 26695
1DHP_A 234 QRLMPLHNKLFVEPNPIPVKWACKELGLVATdTLRLPMTPITDSGRETVRAALKHA 289 Escherichia coli IAI1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap