Conserved Protein Domain Family

TIGR00674: dapA 
Click on image for an interactive view with Cn3D
4-hydroxy-tetrahydrodipicolinate synthase
Members of this family are 4-hydroxy-tetrahydrodipicolinate synthase, previously (incorrectly) called dihydrodipicolinate synthase. It is a homotetrameric enzyme of lysine biosynthesis. E. coli has several paralogs closely related to dihydrodipicoline synthase (DapA), as well as the more distant N-acetylneuraminate lyase. In Pyrococcus horikoshii, the bidirectional best hit with E. coli is to an uncharacterized paralog of DapA, not DapA itself, and it is omitted from the seed. The putative members from the Chlamydias (pathogens with a parasitic metabolism) are easily the most divergent members of the multiple alignment. [Amino acid biosynthesis, Aspartate family]
PSSM-Id: 129757
Aligned: 14 rows
Threshold Bit Score: 387.84
Threshold Setting Gi: 14547947
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q04796 236 QKLLPIMKELFKAPNPAPVKTALQLRGLDVG-SVRLPLVPLTEDERLSLSSTISEL 290 Bacillus subtilis subsp. subtilis str. 168
Q04796 236 QKLLPIMKELFKAPNPAPVKTALQLRGLDVG-SVRLPLVPLTEDERLSLSSTISEL 290 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap