Conserved Protein Domain Family
cdh

?
TIGR00672: cdh 
CDP-diacylglycerol diphosphatase, bacterial type
This model finds only bacterial examples of CDP-diacylglycerol pyrophosphatase. The member from Mycobacterium tuberculosis, the only non-proteobacterial example, is only tentatively identified and scores below the trusted cutoff. No homology is detected to functionally similar mammalian enzymes. Alternate names for this enzyme include CDP-diglyceride hydrolase and CDP-diacylglycerol hydrolase. [Fatty acid and phospholipid metabolism, Biosynthesis]
Statistics
?
PSSM-Id: 129755
View PSSM: TIGR00672
Aligned: 4 rows
Threshold Bit Score: 495.224
Threshold Setting Gi: 13124013
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P06282     1 MKKAGLLFLVMIVIAVVAaGIGYWKLTGEESDTLRKIVLEECLPNQQQNQNPSPCAEVKPNAGYVVLKDLNGPLQYLLMP 80  Escherichia coli K-12
CAA26358   1 MKKAGLLFLVMIVIAVVAaGIGYWKLTGEESDTLRKIVLEECLPNQQQNQNPSPCAEVKPNAGYVVLKDLNGPLQYLLMP 80  Escherichia coli
CAA31757   1 MKKTGYFLLAVILIVAAA-GVGYWKFSG-NPDALREIVLEQCLPDQLQHQNPAPCAEVKPRAGYVVFKDRHGPLQYLLMP 78  Salmonella enterica...
Q48248     1 MKKAGFLFLAVMAIVVMS-------LNAKDPNVLRKIVFEKCLPNYEKNQNPSPCIEVKPDAGYVVLKDINGPLQYLLMP 73  Helicobacter pylori...
P06282    81 TYRINGTESPLLTDPSTPNFFWLAWQARDFMSKKYGQPVPDRAVSLAINSRTGRTQNHFHIHISCIRPDVRKQLDNNLAN 160 Escherichia coli K-12
CAA26358  81 TYRINGTESPLLTDPSTPNFFWLAWQARDFMSKKYGQPVPDRAVSLAINSRTGRTQNHFHIHISCIRPDVRKQLITIWRT 160 Escherichia coli
CAA31757  79 TYRINGTESPLLLEPATPNFFWLAWQARGYMSKKYGHDIPDSAVSLAINSRLGRSQDHLHIHISCIRPDVREQLDNDLTR 158 Salmonella enterica...
Q48248    74 TTHISGIESPLLLDPSTPNFFYLSWQARDFMSKKYGQPIPDYAISLTINSSKGRSQNHFHIHISCISLEARKQLDNNLKK 153 Helicobacter pylori...
P06282   161 ISSRWLPLPGGLRGHEYLARRvTESELVQRSPFMMLAEEVPEAREHMGRYGLAMVRQSDNSFVLLATQRNLLTLNRASAE 240 Escherichia coli K-12
CAA26358 161 SAAAGCHCQVVCAGMNTCASG-NGKRTGTTQPIYDAGRRSTEAREHMGRYGLAMVRQSDNSFVLLATQRNLLTLNRASAE 239 Escherichia coli
CAA31757 159 ISTRWLPLPGGLMGHEYLARRvTESELAQRSPFMMLAEEVPEARDHMGRYALAVVRQSDDSFVLLATERNLLTFNRASAE 238 Salmonella enterica...
Q48248   154 INSRWSPLPGGLNGHKYLARRvTESELVQKSPFVMLNKEVPNAYKRMGDYGLAVVQQSDNSFVLLATQFNPLTLNRASAE 233 Helicobacter pylori...
P06282   241 EIQDHQCEILR 251 Escherichia coli K-12
CAA26358 240 EIQDHQCEILR 250 Escherichia coli
CAA31757 239 EIQDHSCAILS 249 Salmonella enterica subsp. enterica serovar Typhimurium
Q48248   234 EIQDHECAILH 244 Helicobacter pylori 26695
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap