11AS


Conserved Protein Domain Family
asnA

?
TIGR00669: asnA 
Click on image for an interactive view with Cn3D
aspartate--ammonia ligase, AsnA-type
This model represents one of two non-homologous forms of aspartate--ammonia ligase (asparagine synthetase) found in E. coli. This type is also found in Haemophilus influenzae, Treponema pallidum and Lactobacillus delbrueckii, but appears to have a very limited distribution. The fact that the protein from the H. influenzae is more than 70 % identical to that from the spirochete Treponema pallidum, but less than 65 % identical to that from the closely related E. coli, strongly suggests lateral transfer. [Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 129752
View PSSM: TIGR00669
Aligned: 4 rows
Threshold Bit Score: 641.188
Threshold Setting Gi: 4139528
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11AS_A   1 MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQT 80  Escherichia coli K-12
O83567   1 MEKSFILQQQGISFAKHTFTQKLMEHLGLIEVQGPLLSQVGDGIQDGLSGREKAVSVSVKQIPGTAFEVVHSLAKWKRHT 80  Treponema pallidum su...
P00963   1 MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQT 80  Escherichia coli K-12
P44338   1 MKKTFILQQQEISFVKNTFTQNLIEQLGIIEVQGPILSQVGNGMQDNLSGIEKAVQVNVKCIPNAVFEVVHSLAKWKRHT 80  Haemophilus influenza...
11AS_A  81 LGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLAPF 160 Escherichia coli K-12
O83567  81 LARYGFQDNEGLFVHMIALRPDEDFLDQVRSVCVDQWDWEKVVPVGSRNLAYLKDTVRKVYGALRESEVLVSERFGLRAF 160 Treponema pallidum su...
P00963  81 LGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLAPF 160 Escherichia coli K-12
P44338  81 LARFNFKEDEGLFVHMKALRPDEDSLDPTHSVYVDQWDWEKVIPEGRRNFAYLKETVNSIYRAIRLTELAVEARFDIPSI 160 Haemophilus influenza...
11AS_A 161 LPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWN 240 Escherichia coli K-12
O83567 161 LPADIVFVQSEELVRRYPHLDSKGREDAICKEHGAVFLIGIGGVLSDGKPHDVRAPDYDDWTTPSEGEYKGLNGDILVWN 240 Treponema pallidum su...
P00963 161 LPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWN 240 Escherichia coli K-12
P44338 161 LPKQITFVHSEDLVKRYPDLSSKERENAICKEYGAVFLIGIGGKLSDGKPHDGRAPDYDDWTTESENGYKGLNGDILVWN 240 Haemophilus influenza...
11AS_A 241 PVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQAGVWPA 320 Escherichia coli K-12
O83567 241 PVLGRAFEVSSMGIRVDEGALRTQLALTGDEDSLACSWHQDLINGRLPQSIGGGIGQSRLAMLLLQRKHIGEVQASVWPR 320 Treponema pallidum su...
P00963 241 PVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPA 320 Escherichia coli K-12
P44338 241 DQLGKAFELSSMGIRVDESALRLQVGLTGDEDHLKMDWHQDLLNGKLPLTIGGGIGQSRLAMLLLRKKHIGEVQSSVWPK 320 Haemophilus influenza...
11AS_A 321 AVRESVPSLL 330 Escherichia coli K-12
O83567 321 SVREEFENIL 330 Treponema pallidum subsp. pallidum str. Nichols
P00963 321 AVRESVPSLL 330 Escherichia coli K-12
P44338 321 EMLEEFSNIL 330 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap