1TD9


Conserved Protein Domain Family
pta

?
TIGR00651: pta 
Click on image for an interactive view with Cn3D
phosphate acetyltransferase
Alternate name: phosphotransacetylase Model contains a gene from E.coli coding for ethanolamine utilization protein (euti) and also contains similarity to malate oxidoreductases [Central intermediary metabolism, Other, Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 273196
View PSSM: TIGR00651
Aligned: 9 rows
Threshold Bit Score: 468.07
Threshold Setting Gi: 6685767
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1TD9_A        25 IVFPEGLDERILEAVSKLAGNKVLNPIVIGNENEIQAk----aKELNLTLGGVKIYDPHTYegmeDLVQAFVERRKGK-A 99  Bacillus subtilis
P47541        20 IIFPEGWSASVLKAVEMLNESKLIQPAVIFHNRQEIP------ANFDKKITHYVIDEMDLT----SYANFVYEKRKHKgM 89  Mycoplasma geni...
P75359        20 IIFPEGWSPTVMEAVNQLQQAGILTPPVIFRTRSEVP------AGFNTAIKHYVIEEMDLT----KYANFVYEKRKHKgM 89  Mycoplasma pneu...
P73662       390 IVLPEGEEIRILKAAASLINHGIVRLTLLGNIEAIEQtv--kiNHIDLDLSKVRLINPKTSpdreRYAETYYQLRKHKgV 467 Synechocystis s...
O83132        18 LVLPEACEQRTLEAARLIVFRNIAAKVFLVGCERDIKnt---aDRCGIDLTDMVVIDPSVSkhrdQFAERYFQKRKHKgI 94  Treponema palli...
ETJ22099     115 IVLPEGDEPRTVKAAAICAERGIATCVLLGNPAEINRva--asQGVELGAGIEIVDPEVVr---eSYVGRLVELRKNKgM 189 Escherichia col...
WP_005667386 187 IVLPEGDEPRTIKAAVLCAERGIAECVLLADPASVQRva--eaQGVKLGKGITIINPADVr---eNYVDRLVELRKAKgM 261 Haemophilus inf...
WP_003243393  19 IVFPEGLDERILEAVSKLAGNKVLNPIVIGNENEIQAk----aKELNLTLGGVKIYDPHTYegmeDLVQAFVERRKGK-A 93  Bacillus subtilis
O51535        32 IVFPESSDSRVLKAAIVILQKNLADSIILIGKKDTVInslkefSNCNDILGRIEVVDPNSFpdieMYLDEYWSLQKLKgV 111 Borrelia burgdo...
1TD9_A       100 TEEQARKALLDENYFGTMLVYKGLADGLVSGAAHSTADTVRPALQIIKTKEgvkKTSGVFIMARGE------------EQ 167 Bacillus subtilis
P47541        90 DLKEAQKFVRDPSSLAATLVALKVVDGEVCGKEYATKDTLRPALQLLATGN---FVSSVFIMEKGE------------ER 154 Mycoplasma geni...
P75359        90 EMREAQKFVRDASSLAATLVALNEVDGEVCGKEYATKDTLRPALQLLGTGN---FVSSVFIMEKNE------------ER 154 Mycoplasma pneu...
P73662       468 TLAMARDILTDISYFGTMMVHLGEADGMVSGSVNTTQHTVRPALQIIKTQPgfsLVSSVFFMCLED------------RV 535 Synechocystis s...
O83132        95 SLAQAAEDMRDPLRFAAMMLDQGHADAMVAGAENTTARVLRAGLTIIGTLPsvkTASSCFVMDTNNprlg-----gtrGL 169 Treponema palli...
ETJ22099     190 TETVAREQLEDNVVLGTLMLEQDEVDGLVSGAVHTTANTIRPPLQLIKTAPgssLVSSVFFMLLPE------------QV 257 Escherichia col...
WP_005667386 262 TETAAREQLEDTVVLGTMMLEANEVDGLVSGAVHTTANTIRPPMQIIKTAPgssIVSSIFFMLLPD------------QV 329 Haemophilus inf...
WP_003243393  94 TEEQARKALLDENYFGTMLVYKGLADGLVSGAAHSTADTVRPALQIIKTKEgvkKTSGVFIMARGE------------EQ 161 Bacillus subtilis
O51535       112 TKQSLKTQVLDEITFAMLMVRFGYAKSCVCGAVSTSAKVLSNALRIIPKLEgvkIISSFMIMDTLCtarnvdfcfghnGI 191 Borrelia burgdo...
1TD9_A       168 YVFADCAINIAPDSQDLAEIAIESANTAKMFD-IEPRVAMLSFSTKGSA--KSDETEKVADAVKIAKEKAPEL--TLDGE 242 Bacillus subtilis
P47541       155 LYFTDCAFAVYPNSQELATIAENTFNFAKSLNeDEIKMAFLSYSTLGSG--KGEMVDKVVLATKLFLEKHPELhqSVCGE 232 Mycoplasma geni...
P75359       155 LYFTDCAFAVYPSPQELAVVAENTFKFAQSMGePELKMVFLSYSTLGSG--KGEAVDKVVSATQIFLEKHPELkaNVCGE 232 Mycoplasma pneu...
P73662       536 LVYGDCAVNPDPNAEQLAEIALTSAATAKNFG-IEPRVALLSYSSGSSG--QGADVEKVRQATAIAKEREPDL--ALEGP 610 Synechocystis s...
O83132       170 FIFSDCAVIPTPTAEQLADIACSAAESCRTFIgEEPTVALLSYSTKGSGgdSDENILRVREAVRILHERRVDF--TFDGE 247 Treponema palli...
ETJ22099     258 YVYGDCAINPDPTAEQLAEIAIQSADSAAAFG-IEPRVAMLSYSTGTSG--AGSDVEKVREATRLAQEKRPDL--MIDGP 332 Escherichia col...
WP_005667386 330 LVYGDCAVNPDPTAEQLAEIAIQSADSAKAFG-IDPKVAMISYSTGTSG--SGADVEKVKEATRIAKEKRPDL--LIDGP 404 Haemophilus inf...
WP_003243393 162 YVFADCAINIAPDSQDLAEIAIESANTAKMFD-IEPRVAMLSFSTKGSA--KSDETEKVADAVKIAKEKAPEL--TLDGE 236 Bacillus subtilis
O51535       192 LFFADCSVVVNPNSLELAEIALQSAKSFKDILnAKPKVALLSFSTKGSS--SAKETEKVKNALNIVRNKESDL--LIDGE 267 Borrelia burgdo...
1TD9_A       243 FQFDAAFVPSVAEKKAPDSEIKGDANVFVFPSLEAGNIGYKIAQRLGNFEAVGPILQGLNMPVNDLSRGCNAEDVYNLAL 322 Bacillus subtilis
P47541       233 LQFDAAFVEKVRLQKAPQLTWKNSANIYVFPNLDAGNIAYKIAQRLGGYDAIGPIVLGLSSPVNDLSRGASVSDIFNVGI 312 Mycoplasma geni...
P75359       233 LQFDSAFVEKVRKQKAPNLTWNGSANIYVFPNLDAGNIGYKIAQRLGGYEAIGPIVLGLARPFNDLSRGASVSDVFNVGI 312 Mycoplasma pneu...
P73662       611 IQYDAAVDSTVAAQKMPGSAVAGKATVFIFPDLNTGNNTYKAVQRETKAIAIGPILQGLNKPVNDLSRGCLVEDIINTVV 690 Synechocystis s...
O83132       248 LQLDAALVPKITEKKAPHSPITGKVNTLVFPDLSSGNIGYKLVQRLSDADAYGPFLQGFAKPLSDLSRGCSVEDIVAACA 327 Treponema palli...
ETJ22099     333 LQYDAAVMADVAKSKAPNSPVAGRATVFIFPDLNTGNTTYKAVQRSADLISIGPMLQGMRKPVNDLSRGALVDDIVYTIA 412 Escherichia col...
WP_005667386 405 LQYDAAVMEDVARSKAPNSPVAGKATVFVFPDLNTGNTTYKAVQRSADLVSIGPMLQGMRKPVNDLSRGALVDDIVYTIA 484 Haemophilus inf...
WP_003243393 237 FQFDAAFVPSVAEKKAPDSEIKGDANVFVFPSLEAGNIGYKIAQRLGNFEAVGPILQGLNMPVNDLSRGCNAEDVYNLAL 316 Bacillus subtilis
O51535       268 LQLDSAIIKDVAEKKCRESLVAGSANVLIFPNLDAGNIGYKLVERFAFAKAYGPFLQGFSKPISDLSRGCSVDEIVFASA 347 Borrelia burgdo...
1TD9_A       323 ITA 325 Bacillus subtilis
P47541       313 ITA 315 Mycoplasma genitalium G37
P75359       313 ITA 315 Mycoplasma pneumoniae M129
P73662       691 ITA 693 Synechocystis sp. PCC 6803 substr. Kazusa
O83132       328 VTL 330 Treponema pallidum subsp. pallidum str. Nichols
ETJ22099     413 LTA 415 Escherichia coli DORA_A_5_14_21
WP_005667386 485 LTA 487 Haemophilus influenzae
WP_003243393 317 ITA 319 Bacillus subtilis
O51535       348 LMI 350 Borrelia burgdorferi B31
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap