Conserved Protein Domain Family
recU

?
TIGR00648: recU 
recombination protein U
The Bacillus protein has been shown to be required for DNA recombination and repair. RJD 11/20/00 [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129734
View PSSM: TIGR00648
Aligned: 3 rows
Threshold Bit Score: 244.092
Threshold Setting Gi: 2496401
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9ZAG8  31 GRGMSLEKDIEHSNTFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYYIDFEAKETKNKT 110 Staphylococcus aureus...
P39792  30 NRGMTLEDDLNETNKYYLTNQIAVIHKKPTPVQIVNVHYPKRSAAVIKEAYFKQSSTTDYNGIYKGRYIDFEAKETKNKT 109 Bacillus subtilis sub...
Q49422   5 NRGMLLETIVNQTIARLKDHPDIWLEKRFLPIKPIAFRHAHVSGNVS------QKSKTDYYGIYKGMYFDFEAKQT-NKS 77  Mycoplasma genitalium...
Q9ZAG8 111 SFPLNNIHDHQVEHMKNAYQQKGIVFLMIRfkTLDEVYLLPYSKFEVFWKRYKDNIKKSITVDEIRKNGYHIPYQYQPRL 190 Staphylococcus aureus...
P39792 110 SFPLQNFHDHQIEHMKQVKAQDGICFVIIS--AFDQVYFLEADKLFYFWDRKEKNGRKSIRKDELEETAYPISLGYAPRI 187 Bacillus subtilis sub...
Q49422  78 NFPIAQIAEHQLNHLKRIDQIGGVSFLLIYfqTKDQIFAFHTKDLLETIKNQES---KTIKRELIEQKSQKVPLLYPGII 154 Mycoplasma genitalium...
Q9ZAG8 191 DYLKAVDKL 199 Staphylococcus aureus subsp. aureus Mu50
P39792 188 DYISIIEQL 196 Bacillus subtilis subsp. subtilis str. 168
Q49422 155 DLISIIQSF 163 Mycoplasma genitalium G37
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap