Conserved Protein Domain Family
MG010

?
TIGR00646: MG010 
DNA primase-related protein
The DNA primase DnaG of E. coli and its apparent orthologs in other eubacterial species are approximately 600 residues in length. Within this set, a conspicuous outlier in percent identity, as seen in a UPGMA difference tree, is the branch containing the Mycoplasmas. This lineage is also unique in containing the small, DNA primase-related protein modelled here, which is homologous to the central third of DNA primase. Several small regions of sequence similarity specifically to Mycoplasma sequences rather than to all DnaG homologs suggests that the divergence of this protein from DnaG post-dated the separation of bacterial lineages. The function of this DNA primase-related protein is unknown. [Unknown function, General]
Statistics
?
PSSM-Id: 129732
View PSSM: TIGR00646
Aligned: 2 rows
Threshold Bit Score: 386.998
Threshold Setting Gi: 1351456
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P47256   1 MDVRTERLNELFFVYHKNLKnqskskYSRAVNYLKRRGFNLQDFLKVGGGVGYLQNKEWLNLPLYSFDGNLIGFLNRKVS 80  Mycoplasma genitalium...
P75099   1 MELRNTKLEQLFYIYHRNLK------YRCPMQYLTKRGFNLQDLLSVGGGLAYLGEKQWLNLSLYNFNNQLVGFLSRKVG 74  Mycoplasma pneumoniae...
P47256  81 YKKEFLYTPFNKPPSKSEAFVGLRELVIKDNSIYLVEGDFDWLAFRKAGILNSLPLCGLTISNQQVQWLKQKKIKKIFIC 160 Mycoplasma genitalium...
P75099  75 FEKKFLYLPINKPPSKSESFLGLKHLPTETNTIYLVEGDFDWLAFRKGGILNCLPLCGLTLSDKQMKFFQQSKIEKVVLC 154 Mycoplasma pneumoniae...
P47256 161 FDNDLAGKNGAKNLKEYLTKQGFITKVIEIKAAAKDWNDLFLLNNSNWSAVLTNQLLF 218 Mycoplasma genitalium G37
P75099 155 LDNDFAGKVAAANLERILKNAGFQVKVVQLKGKVKDWNELLLLYPKNWAKALRDHLAL 212 Mycoplasma pneumoniae M129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap