Conserved Protein Domain Family
HI0507

?
TIGR00645: HI0507 
TIGR00645 family protein
This conserved hypothetical protein with four predicted transmembrane regions is found in E. coli, Haemophilus influenzae, and Helicobacter pylori, among completed genomes. A similar protein from Aquifex aeolicus appears to share a central region of homology and a similar overall arrangement of hydrophobic stretches, and forms a bidirectional best hit with several members of the seed alignment. However, it is uncertain whether the observed similarity represents full-length homology and/or equivalent function, and so it is excluded from the seed and scores below the trusted cutoff. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129731
View PSSM: TIGR00645
Aligned: 3 rows
Threshold Bit Score: 208.143
Threshold Setting Gi: 8928453
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P44010  16 QSNIIAKIIFASRWLQVPIYLGLIVTLAIYSYKFIKGLWELVINVNDMDSNTIMLGVLNLIDVVMIANLLVMVTIGGYEI 95  Haemophilus influenza...
O24989   2 LEKLIERVLFATRWLLAPLCIAMSLVLVVLGYVFMKELWHMLSHLNTISETDLVLSALGLVDLLFMAGLVLMVLLASYES 81  Helicobacter pylori 2...
P52082   1 MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSLVDMTLVGGLLVMVMFSGYEN 80  Escherichia coli
P44010  96 FVSKLRTRNHPDqPEWMSHVNATVLKVKLSMSIIGISSIHMLQTFVNASN----MPE------KTMMWQLLLHLGFLVSA 165 Haemophilus influenza...
O24989  82 FVSKLDKVDASE-ITWLKHTDFNALKLKVSLSIVAISAIFLLKRYMSLEDvlssIPKdtplshNPIFWQVVIHLVFVCSA 160 Helicobacter pylori 2...
P52082  81 FVSQLDISENKEkLNWLGKMDATSLKNKVAASIVAISSIHLLRVFMDAKN----VPD------NKLMWYVIIHLTFVLSA 150 Escherichia coli
P44010 166 IALAYTDKILYStSHKTH 183 Haemophilus influenzae Rd KW20
O24989 161 LLAAVTNNIAFS-QNKAH 177 Helicobacter pylori 26695
P52082 151 FVMGYLDRLTR--HN--H 164 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap