1C3E,3DA8


Conserved Protein Domain Family
PurN

?
TIGR00639: PurN 
Click on image for an interactive view with Cn3D
phosphoribosylglycinamide formyltransferase, formyltetrahydrofolate-dependent
This model describes phosphoribosylglycinamide formyltransferase (GAR transformylase), one of several proteins in formyl_transf (pfam00551). This enzyme uses formyl tetrahydrofolate as a formyl group donor to produce 5'-phosphoribosyl-N-formylglycinamide. PurT, a different GAR transformylase, uses ATP and formate rather than formyl tetrahydrofolate. Experimental proof includes complementation of E. coli purN mutants by orthologs from vertebrates (where it is a domain of a multifunctional protein), Bacillus subtilis, and Arabidopsis. No archaeal example was detected. In phylogenetic analyses, the member from Saccharomyces cerevisiae shows a long branch length but membership in the family, while the formyltetrahydrofolate deformylases form a closely related outgroup. [Purines, pyrimidines, nucleosides, and nucleotides, Purine ribonucleotide biosynthesis]
Statistics
?
PSSM-Id: 161973
View PSSM: TIGR00639
Aligned: 10 rows
Threshold Bit Score: 273.478
Threshold Setting Gi: 237640472
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1C3E_A          1 MNIVVLISGNGSNLQAIIDACKT--NKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDS-------------RE 65   Escherichia coli
P43846          2 KKIAVLISGQGTNLQTIIDACHS--GDIPAKIACVISNKADAYGLVRAKQAQIPQAVFLRKNFSN-------------NL 66   Haemophilus i...
P08179          1 MNIVVLISGNGSNLQAIIDACKT--NKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDS-------------RE 65   Escherichia c...
P00967       1154 KRVAVLISGTGSNLQALIDATRDsaQGIHADVVLVISNKPGVLGLQRATQAGIPSLVISHKDFAS-------------RE 1220 fruit fly
P12040          2 KKFAVFASGNGSNFEAIVTRLKE--ENWDASAALLVCDKPQAKVIERAEAFHIPSFAFEPKSYEN-------------KA 66   Bacillus subt...
CAB01994       13 ARLVVLASGTGSLLRSLLDAAVG---DYPARVVAVGVDR-ECRAAEIAAEASVPVFTVRLADHPS-------------RD 75   Mycobacterium...
WP_010880522    2 LKIGVLVSGRGSNLQAIIDAIES--GKVNASIELVISDNPKAYAIERCKKHNVECKVIQRKEFPS-------------KK 66   Aquifex aeolicus
P04161          2 ARIVVLISGSGSNLQALIDAQKQgqLGEDAHIVSVISSSKKAYGLTRAADNNIPTKVCSLYPYTKgiakedkaarakaRS 81   Saccharomyces...
WP_010873539   29 LSLGIMASGSGSNFEAIAKAIKE--GKLNAVVKLVIYNNPNAGVRKRAMDHGVPHRLLNHRDYDS-------------RE 93   Synechocystis...
3DA8_A         13 ARLVVLASGTGSLLRSLLDAAV---GDYPARVVAVGVDR-ECRAAEIAAEASVPVFTVRLADHPS-------------RD 75   Mycobacterium...
1C3E_A         66 AYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGR-LLNIHPSLLPKYPG-LHTHRQALENGDEE-----HGTSVHF 138  Escherichia coli
P43846         67 EMDDAIGDYLQSLAVDLIVLAGYMKILTPKFTQRFAGK-ILNIHPSLLPKYAG-LNTYQRAIEAGDNE-----HGTTVHF 139  Haemophilus i...
P08179         66 AYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGR-LLNIHPSLLPKYPG-LHTHRQALENGDEE-----HGTSVHF 138  Escherichia c...
P00967       1221 VYDAELTRNLKAARVDLICLAGFMRVLSAPFVREWRGR-LVNIHPSLLPKYPG-LHVQKQALEAGEKE-----SGCTVHF 1293 fruit fly
P12040         67 AFEQAIIEQLRLHEVELIALAGYMRLIGDTLLQAYGGK-IINIHPSLLPAFPG-IDAVGQAFRAGVKV-----AGITVHY 139  Bacillus subt...
CAB01994       76 AWDVAITAATAAHEPDLVVSAGFMRILGPQFLSRFYGR-TLNTHPALLPAFPG-THGVADALAYGVKV-----TGATVHL 148  Mycobacterium...
WP_010880522   67 EFEERMALELKKKGVELVVLAGFMRILSHNFLKYFPNK-VINIHPSLIPAFQG-LHAQKQAVEFGVKF-----SGCTVHI 139  Aquifex aeolicus
P04161         82 QFENDLAKLVLEEKPDVIICAGWLLILGSTFLSQLQSVpILNLHPALPGCFDGtTHAIEMAWRKCQDEnkpltAGCMVHY 161  Saccharomyces...
WP_010873539   94 DLDQDIVEHFRQAGVEWVIMAGWMRIVTPVLLDAFSRR-VLNIHPSLLPSFRG-VRAVEQALAAGVKV-----SGCTVHY 166  Synechocystis...
3DA8_A         76 AWDVAITAATAAHEPDLVVSAGFMRILGPQFLSRFYGR-TLNTHPALLPAFPG-THGVADALAYGVKV-----TGATVHL 148  Mycobacterium...
1C3E_A        139 VTDELDGGPVILQAKVPVFA-GDSEDDITARVQTQEHAIYPLVISWFADGRLK 190  Escherichia coli
P43846        140 VNEEVDGGAIVLQAKVPIFP-EDSIEEVEARTREQEYQIYPLVIKWFTEGRLR 191  Haemophilus influenzae Rd KW20
P08179        139 VTDELDGGPVILQAKVPVFA-GDSEDDITARVQTQEHAIYPLVISWFADGRLK 190  Escherichia coli K-12
P00967       1294 VDEGVDTGAIIVQAAVPILP-DDDEDSLTQRIHKAEHWAFPRALAMLVNGTAL 1345 fruit fly
P12040        140 VDEGMDTGPIIAQKAIEIDE-HDTLETIEQRIHKLEHKWYPSVIKQLLGLNNR 191  Bacillus subtilis subsp. subtilis str. 168
CAB01994      149 VDAGTDTGPILAQQPVPVLD-GDDEETLHERIKVTERRLLVAAVAALATHGVT 200  Mycobacterium tuberculosis H37Rv
WP_010880522  140 VDESVDAGPVIVQAVVPVLP-EDDENTLADRILKWEHKILPQTVQWFAQDRII 191  Aquifex aeolicus
P04161        162 VIEEVDKGEPLVVKKLEIIPgEETLEQYEQRVHDAEHIAIVEATYKVLQQLHK 214  Saccharomyces cerevisiae S288c
WP_010873539  167 AEATVDSGPIVAQAVVPILA-DDTGETLHQRIQVQEHRLFPLAIALAAQQSP- 217  Synechocystis sp. PCC 6803
3DA8_A        149 VDAGTDTGPILAQQPVPVLD-GDDEETLHERIKVTERRllvaavaalathgvt 200  Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap