1IN4


Conserved Protein Domain Family
ruvB

?
TIGR00635: ruvB 
Click on image for an interactive view with Cn3D
Holliday junction DNA helicase, RuvB subunit
All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129721
View PSSM: TIGR00635
Aligned: 14 rows
Threshold Bit Score: 447.517
Threshold Setting Gi: 2498873
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1IN4_A        22 KSLDEFIGQENVKKKLSLALEAAKMRGEVLDHVLLAGPPGLGKTTLAHIIASELQTNIHVTSGPVLVKQGDMAAILTSLE 101 Thermotoga mari...
Q56313        22 KSLDEFIGQENVKKKLSLALEAAKMRGEVLDHVLLAGPPGLGKTTLAHIIASELQTNIHVTSGPVLVKQGDMAAILTSLE 101 Thermotoga mari...
Q57396        45 QRLADYIGQRDLKEVLRIAIQAAQGRQEAIDHLLLYGPPGLGKTTLALILAEEMQVRCKITAAPALERPRDITGLLLALQ 124 Synechocystis s...
Q50629        27 RSLREFIGQPRVREQLQLVIEGAKNRGGTPDHILLSGPPGLGKTSLAMIIAAELGSSLRVTSGPALERAGDLAAMLSNLV 106 Mycobacterium t...
P96115        27 RLLKDFLGQEKTKRNLRLFIQAARDRNESLDHLFLIGPPGLGKTTLAHITACELGVECKVTGAPALDKPKDLAGILTALS 106 Treponema palli...
P70828        28 KVFEDFKGQVNVKETLSIFIRASKERDEALDHVFLSGPPGLGKTTLASIIAFEMNASIKITSAPAFDKPKDIIGILTGLD 107 Borrelia burgdo...
O84044        21 KKLTEFCGQKQLKERLDLFLRAAVQRNEVPGHCLFYGPPGLGKTSLAHIMANTIGKGLVIASGPQLLKPSDLIGLLTGLQ 100 Chlamydia trach...
Q49425         9 NTFDEFVGKQEIISQIQLSIKASKLNKTQLDHILLYGPPGVGKTTLARLIANELKTKLQIIQGGHLQKPSDFLNAISLIK 88  Mycoplasma geni...
WP_031600749  26 QNLAQYIGQHKVKENLRVFIDAAKMRQETLDHVLLYGPPGLGKTTLASIVANEMGVELRTTSGPAIERPGDLAAILTALE 105 Bacillus subtilis
O25699        24 SLWEDFIGQEKIKSNLQISICAAKKRQESLDHMLFFGPPGLGKTSISHIIAKEMETNIKITAAPMIEKSGDLAAILTNLQ 103 Helicobacter py...
1IN4_A       102 RGDVLFIDEIHRLNKAVEELLYSAIEDFQIDIMIGKGPSAKSIRIDIQPFTLVGATTRSGLLSSPLRSRFGIILELDFYT 181 Thermotoga mari...
Q56313       102 RGDVLFIDEIHRLNKAVEELLYSAIEDFQIDIMIGKGPSAKSIRIDIQPFTLVGATTRSGLLSSPLRSRFGIILELDFYT 181 Thermotoga mari...
Q57396       125 PGDILFIDEIHRLNRLTEELLYPAMEDFRLDITMGKGQSAKVRSLKLAHFTLVGATTKVGSLTSPLRDRFGLIQRLRFYE 204 Synechocystis s...
Q50629       107 EHDVLFIDEIHRIARPAEEMLYLAMEDFRVDVVVGKGPGATSIPLEVAPFTLVGATTRSGALTGPLRDRFGFTAHMDFYE 186 Mycobacterium t...
P96115       107 ERSVFFVDEIHRLKPAIEEMLYIAMEDYELDWVIGQGPSARTVRIPLPPFTLIGATTRAGMVSSPLISRFGIVERFEFYT 186 Treponema palli...
P70828       108 EKSVLFIDEIHRLRPIIEEMLCIAMEDYELDWVIGQGANARTVRMPLPKFTLIGATTKPGKVTSPLYARFGITARFELYS 187 Borrelia burgdo...
O84044       101 EGDIFFIDEIHRMGKAAEEYLYPAMEDFKVDITLDSGPGARSVRLDLAPFTLVGATTRAGMLSEPLRTRFAFTGRVDYYT 180 Chlamydia trach...
Q49425        89 KGDVLFIDEIHAVAPNVMELMYPVMDVFKIQVLIGKDFNSKIVEMKVNPFTLIGATTQLGKIINPLEDRFGVILNINYYS 168 Mycoplasma geni...
WP_031600749 106 PGDVLFIDEIHRLHRSIEEVLYPAMEDFCLDIVIGKGPSARSVRLDLPPFTLVGATTRVGLLTAPLRDRFGVMSRLEYYT 185 Bacillus subtilis
O25699       104 AKDILFIDEIHRLSPAIEEVLYPAMEDFRLDIIIGSGPAAQTIKIDLPPFTLIGATTRAGMLSNPLRDRFGMSFRMQFYN 183 Helicobacter py...
1IN4_A       182 VKELKEIIKRAASLMDVEIEDAAAEMIAKRSRGTPRIAIRLTKRVRDMLTVVKADRINTDIVLKTMEV-LNIDDEGLDEF 260 Thermotoga mari...
Q56313       182 VKELKEIIKRAASLMDVEIEDAAAEMIAKRSRGTPRIAIRLTKRVRDMLTVVKADRINTDIVLKTMEV-LNIDDEGLDEF 260 Thermotoga mari...
Q57396       205 VDELQQIILRTAGILSVSISPTGAEAIAMRARGTPRIANRLLKRVRDYAQVKQQPEIDPALASEALDL-YQVDKRGLDWT 283 Synechocystis s...
Q50629       187 PAELERVLARSAGILGIELGADAGAEIARRSRGTPRIANRLLRRVRDFAEVRADGVITRDVAKAALEV-YDVDELGLDRL 265 Mycobacterium t...
P96115       187 PEELAAIVQRSARLLDITLDARAALALARCSRGTPRVANRLLRRIRDFAQVAGSAHISETIVRAGLAH-LKIDELGLELH 265 Treponema palli...
P70828       188 EIELVEIIKRNSLILNIEIEEDAAFLLARSSRGTPRIANRLLRRIRDIAQVTGSLVITSDIVSIGLEM-LRIDGEGLDEQ 266 Borrelia burgdo...
O84044       181 DEDLVSILSRSSQLLAIEANQETLLEIARRARGTPRLANNLLRWVRDFAQMREGNCINSAVAEKALAM-LLIDNLGLNEI 259 Chlamydia trach...
Q49425       169 NAEIEKMVSIYGKQMKLELNSNEISAITEHSKQTPRIAIRIVRR------IFEQKIVNKKIDLEGLFKnLMIYKNGLQSI 242 Mycoplasma geni...
WP_031600749 186 QEELADIVTRTADVFEVEIDKPSALEIARRSRGTPRVANRLLRRVRDFAQVLGDSRITEDISQNALER-LQVDRLGLDHI 264 Bacillus subtilis
O25699       184 PSELALIIKKAAVKLNQDIKQESADEIAKRSRGTPRIALRLLKRVRDFALVKNSSLMDLNITLHALNE-LGVNELGFDEA 262 Helicobacter py...
1IN4_A       261 DRKILKtIIEIYRGGPVGLNALAASLGVEADTLSEVYEPYLLQAGFLARTPRGRIVTEKAYKHLKY 326 Thermotoga maritima
Q56313       261 DRKILKtIIEIYRGGPVGLNALAASLGVEADTLSEVYEPYLLQAGFLARTPRGRIVTEKAYKHLKY 326 Thermotoga maritima MSB8
Q57396       284 DRLVLQtLIEQFQGGPTGLEAIAAATGEDAKTIEEVYEPYLLQIGYLARTSRGRIATTAAYEHLGL 349 Synechocystis sp. PCC 6803 su...
Q50629       266 DRAVLSaLTRSFGGGPVGVSTLAVAVGEEAATVEEVCEPFLVRAGMVARTPRGRVATALAWTHLGM 331 Mycobacterium tuberculosis
P96115       266 DIQLLRvMIEHFGGGPVGAETLAISLGESPETLEDYYEPYLIQIGLMQRTPRGRMATARAYAHLGL 331 Treponema pallidum subsp. pal...
P70828       267 DRNILRsLILKFNGGPVGVDTLAISVGETADSLEDFYEPYLIMKGFISRTHRGRKATEFAYLHLNL 332 Borrelia burgdorferi B31
O84044       260 DIKLLSvMIDFYQGGPVGMKTLAMAVGEDVRTLEDMYEPFLILKGLVQRTARGRVATPLAYEHLNR 325 Chlamydia trachomatis D/UW-3/CX
Q49425       243 DVQYLEvLNRQNE--PQGIKSISSMLGIDRHTIENKIEPFLLRENMIQKTKKGRIITNSGREYLVN 306 Mycoplasma genitalium G37
WP_031600749 265 DHKLLMgMIEKFNGGPVGLDTISATIGEESHTIEDVYEPYLLQIGFIQRTPRGRIVTPAVYHHFQM 330 Bacillus subtilis
O25699       263 DLAYLS-LLANAQGKPVGLNTIAASMREDEGTIEDVIEPFLLANGYLERTAKGRIATPKTHELLKI 327 Helicobacter pylori 26695
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap